SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011413 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011413
Domain Number 1 Region: 240-363
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000518
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 156-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000116
Family EGF-type module 0.026
Further Details:      
 
Domain Number 3 Region: 25-103,140-199
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000235
Family Growth factor receptor domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011413   Gene: ENSMODG00000009146   Transcript: ENSMODT00000011633
Sequence length 477
Comment pep:novel chromosome:BROADO5:8:13308611:13316725:1 gene:ENSMODG00000009146 transcript:ENSMODT00000011633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHGRLLLLLLLLGPASPQDPEEPDSYMECTDGYEWDTETQHCKDVNECETIPDACKGEMK
CINHYGGYLCLPRSAAVINDSPREAEHTWGACGGAHAGRTCVRPGRTKGRGPLLSNAAVA
DGPASEEGSLGAVRGWHPLPHPLGSRVTPASALRFWVPDIDECELNFHDCRPSQECHNLP
GSFHCSCPDGYRKMGSECVGKAPEPARPPCLSARTALVDGVPCLPPWPWAWLLLPADVNE
CEMGAPCEQRCLNSYGTFLCRCHQGYELHRDGFSCNDIDECRHSTYLCQFHCANEPGRFS
CHCPQGYQLLGTRLCQDIDECESGAHQCSDGQSCVNFHGGYRCVETNRCSEPYVQVSDNR
CLCPASNPRCREQPSSIVHRYMSITSERSVPADVFQIQATSVYPGAYNAFQIRAGNPQGD
FYIRQINNVSAMLVLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYAF
Download sequence
Identical sequences F7B0U4
ENSMODP00000011413 ENSMODP00000011413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]