SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011457 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011457
Domain Number 1 Region: 250-420
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.14e-49
Family SPRY domain 0.0000662
Further Details:      
 
Domain Number 2 Region: 36-97
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000717
Family B-box zinc-binding domain 0.002
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000011457
Domain Number - Region: 87-177
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.00115
Family C-terminal domain of PLC-beta 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011457   Gene: ENSMODG00000009182   Transcript: ENSMODT00000011677
Sequence length 420
Comment pep:novel chromosome:BROADO5:1:657745581:657758293:1 gene:ENSMODG00000009182 transcript:ENSMODT00000011677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLQCRETFLWRDLLPKRQLHRLVESLVCWLLLQIAMDSPSKLCATHREALKLFSQEDQRP
ICMVCHAIRVHATHRLLSVDEAVQDCPDKLSTQLAFLKTEKEETLETKLRGEREIQDMLN
LISVEMEKVTNNFRTMQEFLKDQEKSLLVQMEELNRDIAEWKEQFSTQLSSKVSHLCNLM
AEVEEQRQCPVLELSESNSSIICFFRVEMPMATDSAAVFPELRHRVQHLSAKSWVLQKNL
RQFTERLQSELEKRKVQLTLNPDTANCHLLISPDQKTLSFTETPQKLPYSAERFDSHFCV
LGQEAFSSGKHCWEVCVGVGSMEGWAVGVFRASGRRKGEISFSPSGGIWAIQMLQGYYEA
LTTPETPLTLSSPLERLEVSLDFEGGNLTFSDAQRETLIFNFSVDFHEEIFPFFWLWGQG
Download sequence
Identical sequences F7ACZ5
ENSMODP00000011457 13616.ENSMODP00000011457 ENSMODP00000011457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]