SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011490 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011490
Domain Number 1 Region: 4-68
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 1.31e-21
Family Transducin (heterotrimeric G protein), gamma chain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011490   Gene: ENSMODG00000009206   Transcript: ENSMODT00000011710
Sequence length 75
Comment pep:novel chromosome:BROADO5:4:386364830:386369156:1 gene:ENSMODG00000009206 transcript:ENSMODT00000011710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLTTTMSNNMAKIAEARKTVEQLKLEVNIERMKVSKAAAELLAFCESHVKEDPLVTPVPA
AENPFREKRLFCVLL
Download sequence
Identical sequences F6YZA3
ENSMODP00000011490 13616.ENSMODP00000011490 ENSMODP00000011490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]