SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011508 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011508
Domain Number 1 Region: 218-312
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000442
Family DEATH domain, DD 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000011508
Domain Number - Region: 2-52
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000101
Family TNF receptor-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011508   Gene: ENSMODG00000009216   Transcript: ENSMODT00000011728
Sequence length 319
Comment pep:novel chromosome:BROADO5:1:585266444:585271707:-1 gene:ENSMODG00000009216 transcript:ENSMODT00000011728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETVPCHATHNTKCQCRSGTFCPKEHPCEICRKCTSECPREMVEKNPCSPSSDLECQEPTG
TPTGHRDGCQEMGGQSPHTHQWVCQRVSIEVSLDVAVPMLFSHWIIVKFNLYWVLSVFLP
FSASSRAGQTGYLMGDREKEKPYLWGSSREPLLSYLVSLLQRGNHPRPPEARGDEPLEMQ
NLSGKQREEHEELLEEPAEAMTPQAKLFPANGDPIGTLQKSFVIFAQKVPWQYWNQYMNL
LGLSPNEIAMAKESENVIDYPHRMLTMWQQKVGKAATVDILLETLSKIKLKAARESIQEE
LIHEKLYVYKESEPEKSLT
Download sequence
Identical sequences F7EED4
ENSMODP00000011508 13616.ENSMODP00000011508 ENSMODP00000011508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]