SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011527 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011527
Domain Number 1 Region: 32-246
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-66
Family SPRY domain 0.0000000104
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000011527
Domain Number - Region: 235-272
Classification Level Classification E-value
Superfamily SOCS box-like 0.00023
Family SOCS box-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011527   Gene: ENSMODG00000009234   Transcript: ENSMODT00000011747
Sequence length 273
Comment pep:novel chromosome:BROADO5:4:433268531:433363597:-1 gene:ENSMODG00000009234 transcript:ENSMODT00000011747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNDD
RSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATA
DAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVA
LDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDL
CRRSVRLALGKERLSEIHALPLPASLKGYLLYQ
Download sequence
Identical sequences F7EE24
13616.ENSMODP00000011527 XP_001362125.1.35504 XP_016278045.1.35504 XP_020830070.1.61212 XP_020830078.1.61212 ENSMODP00000011527 ENSMODP00000011527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]