SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011624 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011624
Domain Number 1 Region: 94-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000215
Family I set domains 0.045
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000011624
Domain Number - Region: 297-336
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00753
Family TNF receptor-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011624   Gene: ENSMODG00000009302   Transcript: ENSMODT00000011844
Sequence length 347
Comment pep:novel chromosome:BROADO5:6:267906375:268005735:1 gene:ENSMODG00000009302 transcript:ENSMODT00000011844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENAPRVWLWRNRDYGSQFFPPFSLLLFFLLLQKPPSIGYSYSERLSRQATGNTDIVKIV
GSTNAPVKIYVKVNHVSPHLLCIDKRLRNLELIDPVFHWIGPSGKTVSENSYLKITTTGS
LIFYNFKKDMSGVYTCSLSYKLTVEDMEKTVQLEYTIYAYIASNFYYEFTARYHSAPCNN
IYNTAFEKKLLQILSKLIADLSCEVTLVKSECHHVKMQRAGIQNELFFTFSVIAIEKGTK
GTGACTDSSCDSSNRLNKAKSLIKRFFVHQVEVLGKRSEPLPEIYFIEGTLQMVGIDRCN
PGYGINALMHPDCPECCVICTPGTYNPHIGIHCLQCNRSHTFGATKC
Download sequence
Identical sequences F6YX37
ENSMODP00000011624 XP_016280049.1.35504 ENSMODP00000011624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]