SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011676 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011676
Domain Number 1 Region: 578-708
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.14e-29
Family SPRY domain 0.01
Further Details:      
 
Domain Number 2 Region: 520-607
Classification Level Classification E-value
Superfamily Fibronectin type III 1.73e-18
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 3 Region: 301-361
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000244
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Domain Number 4 Region: 2-47
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000379
Family RING finger domain, C3HC4 0.053
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000011676
Domain Number - Region: 210-244
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00199
Family TFIIH p44 subunit cysteine-rich domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011676   Gene: ENSMODG00000009344   Transcript: ENSMODT00000011896
Sequence length 710
Comment pep:novel chromosome:BROADO5:2:163953181:164018439:1 gene:ENSMODG00000009344 transcript:ENSMODT00000011896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEELKCPVCGSLFREPIILPCSHNVCLPCARTIAVQTPDSEQHLPPPLLHTRAPSLPTG
SAAGPPPEYEPGNGPACAGGGTGSGGGGSGGVGGVVGGGDHADKLSLHSETDSGYGSYTP
SLKSPNGVRVLPMVPAPPGSSAAAARGAACSSLSSSSSSSITCPQCHRSASLDHRGLRGF
QRNRLLEAIVHRYQQSRGSGTGTTAAAAVAHCQLCDRTPPEPAATLCEQCDVLYCSACQI
KCHPSRGPFAKHRLVQPPPPQPAASTPLGATQGAPSGSGGSSSSSSKSPGPGAGAAGGTG
VRKFPTCTDHELENYSMYCVSCRTPVCYQCLEEGRHSKHEVKPLGAMWKLHKAQLSQALN
GVSDKAKEAKEFLVQLKNILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKER
EHKLKVVWDQINHCTLKLRQSTGLMEYCLEVIKENDPSGFLQISDALIKRVQVSQEQWVK
GALEPKVSAEFDLTLDSEPLLQAIHQLDFIQMKLPPIPLLQLEKCCTRNNSVTLAWRMPP
FIHSPVEGYILELDDGDGGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSK
TVVLQTSDVAWFTFDPNSGHRDIVLSNDNQTATCSSYDDRVVLGTAAFSKGVHYWELHVD
RYDNHPDPAFGVARVNVVKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNR
Download sequence
Identical sequences F7GAM9
XP_016285747.1.35504 ENSMODP00000011676 ENSMODP00000011676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]