SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011725 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011725
Domain Number 1 Region: 42-372
Classification Level Classification E-value
Superfamily Cytochrome P450 1.96e-80
Family Cytochrome P450 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011725   Gene: ENSMODG00000009383   Transcript: ENSMODT00000011946
Sequence length 413
Comment pep:novel chromosome:BROADO5:1:23172044:23187564:1 gene:ENSMODG00000009383 transcript:ENSMODT00000011946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSSLLASISISELLLASVIFCLVFWVTRSSHQRVPKGLKSPPGPWAWPLFDGYSLAFNP
DSGEVWAVRRKLAQNALNTFSVSSSPSSSSCYLEEHVNKEVKHLIQKFQELMEGVGCFDP
YRHIVASVANVISAMCFSQRYEDHKNPEFTTLINASHEFVESATSGNPVDFFPILRYIPN
PQLQRFKEFNQRFLKFLQNTIREHHKAFDENNIQDITGALYKHSQDKAFGNTSSSVPEML
IINLINDIFGAGFDTVTTAISWSLMYLVTNPKVQKKIQQELDTVIGRDRWPLLSDRPQLP
FMEAFILEIFRHTSFVPFTIPHSTTRATTLNNFYIPKGTCVFVNQWQTNHDPKLWEDPSV
FRPERFLSADGTVNKALSEKKPQLLKTQKKKFSPSNVLTLAVSNVSLPETDTM
Download sequence
Identical sequences F7CPS4
ENSMODP00000011725 ENSMODP00000011725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]