SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011797 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011797
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily DEATH domain 7.79e-24
Family Caspase recruitment domain, CARD 0.0000134
Further Details:      
 
Domain Number 2 Region: 109-194
Classification Level Classification E-value
Superfamily DEATH domain 7.95e-20
Family DEATH domain, DD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011797   Gene: ENSMODG00000009439   Transcript: ENSMODT00000012020
Sequence length 200
Comment pep:novel chromosome:BROADO5:8:70310656:70591818:1 gene:ENSMODG00000009439 transcript:ENSMODT00000012020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METRDKQVLRSLRLELGSEVLVDGLVLQYLYQEGILTENHVQEIRAQSTGLRKTMMLLDI
LPTRGPKAFDTFLDSLQEFPWVREKLEKSREEAIQETPTTGNQASQIPPHILTSSPSDQQ
INQLARKLGPEWEPVALSLGLSQRDIYRCKVNHPYNVQSQIVEAFVQWRQKNGSQATIQS
LQKGLVAMDVDPSVLQHMLE
Download sequence
Identical sequences F7AYR8
XP_001363724.1.35504 13616.ENSMODP00000011797 ENSMODP00000011797 ENSMODP00000011797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]