SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011798 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011798
Domain Number 1 Region: 820-980
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.23e-44
Family MAM domain 0.00073
Further Details:      
 
Domain Number 2 Region: 1263-1421
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.39e-33
Family MAM domain 0.00061
Further Details:      
 
Domain Number 3 Region: 608-772
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.22e-33
Family MAM domain 0.0037
Further Details:      
 
Domain Number 4 Region: 1475-1633
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.02e-33
Family MAM domain 0.00041
Further Details:      
 
Domain Number 5 Region: 1684-1848
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.16e-28
Family MAM domain 0.0014
Further Details:      
 
Domain Number 6 Region: 1046-1212
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.06e-28
Family MAM domain 0.0089
Further Details:      
 
Domain Number 7 Region: 181-338
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-22
Family MAM domain 0.0035
Further Details:      
 
Domain Number 8 Region: 388-548
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.86e-22
Family MAM domain 0.01
Further Details:      
 
Domain Number 9 Region: 2-138
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000807
Family MAM domain 0.012
Further Details:      
 
Domain Number 10 Region: 1219-1257
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 11 Region: 1002-1044
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 12 Region: 1902-1940
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000122
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 13 Region: 343-381
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 14 Region: 1859-1898
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000103
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 15 Region: 1643-1679
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000114
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 16 Region: 571-608
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 17 Region: 1438-1475
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000288
Family LDL receptor-like module 0.0034
Further Details:      
 
Domain Number 18 Region: 1979-2017
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000115
Family EGF-type module 0.039
Further Details:      
 
Domain Number 19 Region: 782-817
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000017
Family LDL receptor-like module 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000011798
Domain Number - Region: 1944-1981
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000419
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011798   Gene: ENSMODG00000009440   Transcript: ENSMODT00000012021
Sequence length 2125
Comment pep:novel chromosome:BROADO5:8:254007510:254989302:-1 gene:ENSMODG00000009440 transcript:ENSMODT00000012021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWTKKNGITSTSPPYQNHNGNESAYFLSLASKTGSSPANIKSRVFHPTNSQRSCQVTFY
HYASHVKIKISVGLQTMCGNSFQTIWQSSAGSPNRWERNTIKINSTQKFQVVIQGQRFST
DGEEEALAIDDISFSEGCQPDLSKNSLCQETLNTCDWTHQQDASLCNYESSFDLESANEK
SCFCQFCGFEFDTCGWSSAKSATEISWVRTKAREKLGFKSTPPKDHGGDIEGHYMWVGAD
NDTFSRSAYLNSSKCQCFGKSCHLRFYYSMADSILTVGLYNDKEKEILWTSDASTMGEWM
KMDVSVPETITTFKFVFEGTVQNREGFIGLDSLQVYSCEETHEPSPCPVEEFSCASGQCI
PSGLECDYQQDCSDQSDEDPSACSNYTLCNFESGFCDWKPLWTKESHWKISKGLSPRGFE
LPHADHTTNSEYGSFIYFGADLLPGVSHLGSPLLTSLNPTSAPCQVRFWYHLSQNSQLSV
FTRTSLDDELQKQSDFLEVSKSQWTRANISVYPMSGKLFLPFQVILQATIFSENATVAID
DISINPDCGLFFASLSNIPIKNKGKEIVAQTGGCEAGFVPCEDASCILSSKVCDFTPDCP
NGMDEAHCATSCDFEIDSCGWFEAHGGDHFDWVRNSSITLSVDVQQQAPAQDHTYNKPQG
HFMFILKTSRSISQVAKLQSPRFSQTGPGCSLSFWFYNYGDSVGAAEMQLHLEGTNYSTA
LWRVLYNQGNQWSKAFIQLGRINQPFYLTLEKVSLGIYNGVSAIDDIRFENCALPLPTVS
CEGPDYFWCRQTKVCIDRLLLCDLVDNCGDATDEANCTPENSCDFENGLCNWEQDKEDDF
DWTRNQGETSTLNTGPMKDNTLGTVKGHYLYIESSEPQVFQNRAVLLSPLLNGTNNKSCI
FRFHYHMFGKHIYRLVIYQRIWSNTRGHVLWQIFGNQGNRWKRKALNITSTQPFQILVEA
SVGDGFTGDIAIDDLSFMDCALYPGNLPENFIPPSGTLIPVTLPPHNCTDDEFVCRSNGH
CIEKIQKCDFRSDCPDQSDEASCVMEVCSFEDGNLCKWYQPELMERSQAINTFRWDLGNG
ASIHHGEENHRPSVDHTKNSTDGYYLYADSSNGKFGHISDIITPVISLTGPKCSLVFWNH
MNGATIGSLQVLIKKDNVTSKLWAQTGQQGAQWKRVEVFLGIHSNIQVCDPINLIVNYMG
DVAVDDIAFQDCSPLVISEKKCTAQEFLCANKYCISKDNLCDFVNDCADNSDENPFICGI
SIGRCDFEFDLCFWEQSQKDDLDWNLKAAITPTTGTEPVADHTFQDPSGHYIFIKSLFPQ
QPMREAHLSTPMISRRSKNCKIIFHYHMYGKGIETLTVSQISVTNNTKVLFHLSGGQDNF
WKRKELILQSEEDFQVIFEGRVGKGHRGHIALDDIVLSKGCFPSHQTIVKEPIALLMSDS
CPHGYRRCQNGKCFRPEQSCNFVDDCGDNTDENECGTSCTFENGSCGWQNSLADNFDWVL
GVGSLLLLSPSRDHTALGNATGHFLHLEATPVGLRGEKAHLKSSQWQESSTACVLTFWYF
ISTKATGSIQVLVKTEKGLSKVWTEEGQNPDNQWKKAEILLGKLRNFEVIFEGIRTRDLG
GGAAIDDIEFKNCSIAGENSEMCPEATDFMCQDKKCIEHHLVCDYKPDCMDSSDEAYCSQ
YTSIPGSCNFENAPHNWTSACHLTQDTQDNLYWNVGNRITTERESLDSDHTPGNGQYFLY
VNSTGPKEGYTARITTTHFFPASLGICTVRFWIYISGSSDMGILKVYIVEESGLEILVWS
MIGNNGRDWMYGNVPLSSNGPFKVTFEADLGGDNLTFIALDDISFTLECKSGGPVTTLPP
PCEAHQFPCVYTPQCVSLSGKCNGQEDCMDGTDELDCPTGSPPQPCRKLEFQCSTNECIP
SLLLCDGVPDCQFNEDESTCSGGHCMDGSLMCPSTNSCIPASQRCDGFVDCTDFQLDESS
CSECPIGYCKNGGTCIIEKNMPICRCISEWRGNRCHIPLSSASPAEVIFTQNGIWTILII
GLTFLTTHLAIALFSFLYNRKQPRKKPEETAYAFANPMYEDGNCSEKTEATGSTVFPRIQ
ISVSPWQAHTETSAYSFANPLYGAT
Download sequence
Identical sequences F7AYR0
ENSMODP00000011798 ENSMODP00000011798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]