SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011856 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011856
Domain Number 1 Region: 1333-1432
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.41e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.000048
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000011856
Domain Number - Region: 467-665
Classification Level Classification E-value
Superfamily Tropomyosin 0.0036
Family Tropomyosin 0.004
Further Details:      
 
Domain Number - Region: 1181-1373
Classification Level Classification E-value
Superfamily Tropomyosin 0.00981
Family Tropomyosin 0.0027
Further Details:      
 
Domain Number - Region: 684-772
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.016
Family Myosin rod fragments 0.003
Further Details:      
 
Domain Number - Region: 241-301
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0994
Family Myosin rod fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011856   Gene: ENSMODG00000009488   Transcript: ENSMODT00000012079
Sequence length 1436
Comment pep:novel chromosome:BROADO5:8:69352687:69491376:-1 gene:ENSMODG00000009488 transcript:ENSMODT00000012079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRILQRTPGRVGSQGSDSDSSATPGNVLDVNNEGSSEGFICPQCMKSHGSAEELFKHY
QAVHDSGNESSHGGEALKREDVILLRQEVQDLQASLKEEKWYSEELKKELEKLQGQRQQE
LKPDGLATDSSAELQSLEQQLDEAQTENFNIKQMKDLFEQKAAQLATEVADIKSKYDEEK
GLREAAEQKATSLTEELKKETTVIQDLKTELLQRPGVEDVAVLKKELVQVQTLMDNMTLE
RERESEKLQEECRKLRADCVNSEVTISQLRNELAKGPQEVAVYVQELQKLQSSVNEFTQK
NQSEYCVLAPRQKNSIPWRYLGSFPDHHSKNLTEKLLKKEQDYIQLEEKQNEEYICKKNI
QANLHQKELDCQQLQSKLSSTEASLQRLQGELVEKGDVSQKLKEELSEVESKYQHLKVEF
KQLQQQREEKEQHAFQLQSEVNQLHSKLLEAERQLGEAHGRLKEQRQLSSEKLMDKEQQV
ADLQLKLSRLEEQLKEKVTNSTELQHQFDKMRQQHQEQQALQQSTTSKLREAQNDLEQVL
RQIGDKDQKIQNLEALLQKSKENITLLEKEREDLYAKIQAGEGETAVLNQLQEKNHTLQE
QVTQLTEKLKNQSESHKQAQENLHEQVQEQKAHLRAAQDRVLALEANISEVNSQLNESKE
KVSQLDLQIKAKTELLLSAEAAKTAQRADLQNHLDTAQNALQDKQQEFNKISNQLDEVTG
QLHDKQEHCIQLEASIKELKEKKLSYEQRAEELEGQVKKLDSDILEIKASKEQIVHDLQE
QRQQNAELNLRVAELSQQLEAEREAVSNAHLDLRKKSDAFEHATQMLSKHEEEKAGLKQE
LQKLHHDAESQRKELDSKVQATLTDLQQVKKERASLEKELSTTKDKLLKTSESLKDTKNE
IEKERQSGKIALAELEKTCKELKHQLQVQTECSIKEKNELKKLFEKEKEVTQQLKLDLSS
TQEQVLHVQNILKEKEKEEEQLQGKLNSLKQLLEQRKKQTEGLQEEMKITLSQKTELENK
LQQQITLSCQDLAAERDKISALQSTYEKSQENLKQLQSDFYGKESELLATRQDLKSVEEK
LSLAQEDLISNRNQLGNQNKMIQELKVAKTSLQQDVAKKEQQLQEQSETLQAMQKDKSLK
EKELANEKSKLMEIQEIKGRQEKEIAKLSEELGSCKQESLKEITNLKDAKQLLIQQKLEL
QGKLDALKSTLEQEKKKQQIVKDQLKKTEDDLRKEFTEKEAKLHTEIKEKEEKIKKHEEN
ETRLAMQVTALNENLSTVKKEWQASQRRVSELEKQIDDLRGEIAVLEATIQNNQDERRAL
LERCLKGEGEIEKLQAKVLELQRKLDNTTAAIQELGRENQSLQIKHTQALNRKWAEDNEV
QNCMSCGKSFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDDCFNDLQG
Download sequence
Identical sequences F7FN86
ENSMODP00000011856 ENSMODP00000011856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]