SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012047 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012047
Domain Number 1 Region: 287-597
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 7.32e-41
Family Galactose oxidase, central domain 0.013
Further Details:      
 
Domain Number 2 Region: 699-868
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-26
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 3 Region: 81-203
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-21
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1005-1051
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000234
Family Laminin-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012047   Gene: ENSMODG00000009640   Transcript: ENSMODT00000012271
Sequence length 1249
Comment pep:novel chromosome:BROADO5:1:94765900:95389049:-1 gene:ENSMODG00000009640 transcript:ENSMODT00000012271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEPGAQQQAAPALRRARAGGGASSWLLDVPSWLLGYGFLYLVLYAQVSQSKPCDRSSSC
FSGRCVNATCLCDQGWVGDQCQHCQGRFKLTEPSGYLTDGPINYKYKTKCTWLIEGYPNA
VLRLRFNHFATECSWDHMYVYDGDSIYAPLIAVLSGLIVPEVRGNETVPEVVTTSGYALL
HFFSDAAYNLTGFNIFYSINSCPNNCSGHGKCTTSVSIPSRVYCECDKYWKGEACDIPYC
KANCGSPDHGYCDLTGEKLCVCNDSWQGPDCSLNVPSTESYWILPNVKPFSPSVGRASHK
AVLHGKFMWVIGGYTFNYSSFQMVLNYNLESSIWNVAPLSRGPLQRYGHSLALYQDNIFM
YGGKIETNNGNVTDELWVFNIHSQSWSTKTPTVLGHGQQYAVEGHSAHIMELDSRDVVMI
IIFGYSAVYGYTSSIQEYHILSNTWLVPETKGAIVQGGYGHTSVYDEMTKSIYVHGGYKA
LPGNKYGLVDDLYKYEVNTKTWTILKESGFARYLHSAVLINGAMLIFGGNTHNDTSLSNG
AKCFSADFLAYDIACDEWKILPKPNLHRDVNRFGHSAVVVNGSMYIFGGFSSVLLNDILV
YKPPNCMAFRDEELCKNAGPGIKCLWNKNHCESWEAGHHNNILRAKCSPKAAATDDRCYR
YADCASCTANTNGCQWCDDKKCISANSNCSMSVKNFTKCHVKNEQICNKLTSCKSCSLNL
NCQWDQRQQECQALPAHLCGEGWNHIGEACLRINSSKENYDNAKLYCYSLSGNLASLTTS
KEVEFVLDEIQKYTQQKVSPWVGLRKINISYWGWEDMSPFTNTTLQWLPGEPNDSGFCAY
LERAEIAGLKANPCTSVADGLVCEKPVVSPNQNARPCKKPCSLRTTCSNCTSNGMECMWC
SSTKRCVDSNAYIISFPYGQCLEWQTATCSPQNCSGLRTCGQCLEQPGCGWCNDPSNTGK
GHCIEGSSRGPMKLVGMHTSEMTLDTNLCPKEKNYEWSFIYCPACQCNGHSTCINNNVCE
QCKNLTTGKQCQDCMPGYYGDPTNGGQCTACTCSGHANICHMHTGKCFCTTKGIKGDQCQ
LCDSENRYVGNPLRGTCYYSLLIDYQFTFSLLQEDDRHHTAINFIANPEQSNKNLDISIN
ASNNFNLNITWSISSTAGTISGEEILLIYRVKIKEFRDSFSCEKFNFRGNPNITFYVYVS
NFSWPIKIQIAFSQHNTIMDLVQFFVTFFSCFSNCSNLVLVVWKVFCSC
Download sequence
Identical sequences F6QTR4
ENSMODP00000012047 ENSMODP00000012047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]