SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012212 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012212
Domain Number 1 Region: 29-199
Classification Level Classification E-value
Superfamily vWA-like 4.75e-46
Family Integrin A (or I) domain 0.0013
Further Details:      
 
Domain Number 2 Region: 508-695
Classification Level Classification E-value
Superfamily vWA-like 1.48e-44
Family Integrin A (or I) domain 0.00092
Further Details:      
 
Domain Number 3 Region: 282-506
Classification Level Classification E-value
Superfamily vWA-like 2.04e-36
Family Integrin A (or I) domain 0.0026
Further Details:      
 
Domain Number 4 Region: 700-736
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000115
Family EGF-type module 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012212   Gene: ENSMODG00000009771   Transcript: ENSMODT00000012437
Sequence length 750
Comment pep:novel chromosome:BROADO5:1:96454212:96487236:-1 gene:ENSMODG00000009771 transcript:ENSMODT00000012437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVLPSLTVQELHANQETIVKISSASQLMQCSAALDVLFALDGSHSIGKGSFERSKYFAIK
MCDALAIYPDRVRVGVLQFSSVPQLEFPLDSFFTREEVKEKIKKIVFKGGSTETGLALKY
LLHKGFPGGRNSSVPQLLIIVTDGKSQGNIDLPANQLKERGVMVFAVGVRFPRWTELHTL
ASEPKDQYVLFAEHVDDATNGLYSTLSSLAICNATAPGCRVEPHLCERKTLETIREVTGS
SMCWRGSKKTKAVFSSLCPFYSWKKVFITHPATCYRTVCPDPCDSQPCQNGGTCVLEGLD
KYHCLCPIGFGGEANCAPTLSLECTVNLLFLLDSSSGTTLEGFLQAKAFLKRFVQAVVSM
DSPTNVAVAQYSKEVEIPVQMGEYQDVPSLMKSLDRMHFTGGPTLTGRALEHVANHGFGD
ILSFGETHVSQPPQVVVLLTDSRSQDLVAGPARYARDRGLFLIGVGGEFLRAELEEITGN
PKQVITYSNPQDLFNKIPELQKRICSLQRPGCQSQSLDLVFLLDASATVGQENFTKLQSF
VRGSSLQFNINRDVTQIGLVVYGSRVQTTFALDTHPTSSSLLQAISQAPYMDGAGSTGSA
LLHVYEEVMTVQKGARPGVSKAVVVITEGTGTEDAVVPAQKLRNNGISVLVIAVGPVLKE
TLLRLAGSPDFLIHVASYEDLENYQDLFIERICEEAKRPVNLCKPSPCMNDGICILQNGS
YRCECRGWEGPHCENRILRGDSPRPHGLHQ
Download sequence
Identical sequences F6TFA3
ENSMODP00000012212 ENSMODP00000012212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]