SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012242 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000012242
Domain Number - Region: 802-834
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00377
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 168-311
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00408
Family Growth factor receptor domain 0.0059
Further Details:      
 
Domain Number - Region: 542-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0311
Family Laminin-type module 0.017
Further Details:      
 
Domain Number - Region: 614-746
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0392
Family Growth factor receptor domain 0.0045
Further Details:      
 
Domain Number - Region: 755-804
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0398
Family Laminin-type module 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012242   Gene: ENSMODG00000009795   Transcript: ENSMODT00000012467
Sequence length 1144
Comment pep:novel chromosome:BROADO5:1:151972833:152464132:-1 gene:ENSMODG00000009795 transcript:ENSMODT00000012467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLSLLAGLMVKMFFLSFLLQTTLSLNPDDPNVCSHWESYAVTVQESYAHPFDQIYYTRC
TDILNWFKCTRHRISYKTAYRRGLRTMYRRRSQCCPGYYENGDVCIPLCTEECVHGHCVS
PDTCHCEPGWGGIDCSSGCDSDHWGPHCSNRCQCQNGALCNPITGACVCADGYRGWRCEE
FCEPGTHGKGCQLPCQCHNGATCDPRTGECHCAPGYTGVYCEEQCPPGSHGAHCDLRCPC
QNGGTCHHITGECACPPGWTGGVCAQPCPPGTFGINCSQNCPCHHGGQCDHVTGRCHCAA
GYMGDRCQEECPIGTFGFQCSQRCDCHNGAQCSPATGACVCDPGYKGPRCQERLCPEGLH
GPQCTNPCPCNATNTLSCHPVSGACTCHAGWASPYCNESCPAGSYGEGCRLQCACQNGAD
CHSITGSCTCAPGFMGEVCALPCASGTYGPNCSSVCACKNEGACSSVDGTCTCKEGWQGI
DCSLPCPTGTWGLSCNETCICANGAACSPIDGTCSCSPGWLGDTCEQSCPDGTYGLNCSE
HCDCNHADGCDPITGHCCCLAGWTGVRCDSTCPPGHWGPNCSISCSCENGGSCSPEDGTC
ECAPGYRGPLCQRICPPGFYGHSCNQPCPLCVHSNGPCHHVTGHCDCLPGFSGSLCNQVC
AGGRFGKDCAQHCSCSNNGTCSPIDGSCQCFPGWIGKDCTQACPAGFWGPACFHTCNCHN
GAGCSADDGACRCAPGWTGLFCTQRCPTAFYGKDCGRVCQCQNGADCDHITGKCSCRTGF
TGRHCEQKCSPGTFGYGCQQLCECMNNATCDHVTGTCYCSQGFKGIRCDQAALMMEELNP
YTKISPALGSERHSVGAVIGIVLLLLVIVALLSLFAWHRRRQKEKGNDMPRVSYTPAMRM
TSTDYSLSDVSQSSSHGQCFSNPSYHALACGVPPETVSNLDRNSSTKLSNKSLDRDTSGW
TPYSYVNVLDSHFQISALEARYPPEDFYIELRHLGRPAEPHTPGACGLDRRQNTYIMEKG
FKDYTKESVSSSSTCSLNSSENPYATIKDPPLLTCKPTESSYVEMKSPAHRDSPYTDMPS
LSASNKNIYEVEPTVSVVQEGRGHSASYIQNPYDLPRNSHIPGHYDLLPVRQSPAHGPSQ
DKQS
Download sequence
Identical sequences F6SYX8
ENSMODP00000012242 XP_001375969.3.35504 ENSMODP00000012242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]