SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012255 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012255
Domain Number 1 Region: 288-531
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.9e-54
Family Crotonase-like 0.0000000124
Further Details:      
 
Domain Number 2 Region: 8-63
Classification Level Classification E-value
Superfamily Chromo domain-like 2.26e-18
Family Chromo domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012255   Gene: ENSMODG00000009804   Transcript: ENSMODT00000012480
Sequence length 544
Comment pep:novel chromosome:BROADO5:3:340477879:340664060:-1 gene:ENSMODG00000009804 transcript:ENSMODT00000012480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLMVTKVVERIVDKRKNKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFNRRHN
EKQKESTLTRTNRTSPNNARKQISRSTNSSFSKTAPKSLVIGKDHDSKNSQLFNASQKFR
KNTSPSLSSRKNMDLAKSGIKILVPKSPIKSRTAVDGFQNESPDKLDHIEQDQEDSVAPE
VAAEKPVGALLGPGAERARMGSRPRIHPLVPQLPVPVTATIASGLTINGKGTSALMDTLA
ANGTTNIQTSVTAVTANKRRFIEDRRDQPFDKRLRFSVRQTESAYRYRDIVVRKQDGFTH
ILLSTKSSENNSLNPEVMKEVQSALNTAAADDSKLVLLSAVGSVFCCGLDFIYFIRRLTD
DRKRESTKMAEAIRNFVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTP
YTTFGQSPDGCSSLMFPKIMGLASANEMLFSGRKLTAQEACAKGLVSQVFWPGTFTQEVM
VRIKELVTCNSVVLEESKALVRSIMKVDLEQANEKECDILKKIWGSAQGMDSMLKYLQRK
IDEF
Download sequence
Identical sequences F6SYB6
XP_001378344.3.35504 XP_007488080.1.35504 XP_007488081.1.35504 ENSMODP00000012255 ENSMODP00000012255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]