SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012296 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000012296
Domain Number - Region: 552-623
Classification Level Classification E-value
Superfamily Prefoldin 0.00392
Family Prefoldin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012296   Gene: ENSMODG00000009821   Transcript: ENSMODT00000012521
Sequence length 907
Comment pep:novel chromosome:BROADO5:1:96588556:96651503:1 gene:ENSMODG00000009821 transcript:ENSMODT00000012521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSELVPVSLSETENRPSILSDRTIGCASTTKEGSTSCFSGDEESSLNDDSKLFPSKKEM
TSLSFPEGDQIEAKKGFSPDHSGVGISCTKADTYEEKSQRIAHFPSGDFAEQVTKTNDTE
QTLTEILQELNSPKLTETSSEKTYSESLYDTDCTKKLISRIQNVSAQEDLLEEIESELLS
AELSNEHRVPNGMKKGEHALVMFEKCVQDKYLQQEHTIKKLIKENKKHQELILEICSEKD
NLREELKKRTETERQHINIIKQLEARIEELNKDINISKEKLVTQDAAAKNTIQQLHKEMA
FRMEQANKKCEEARQEKETMVMKYVRGEKESLDLRKEKEGLERKLRDANKEIEKHVNKVK
QLSQEKGRLHQLYETKESDATRMSREIDKMKEDINSHIIKVKWAQNKLKTEMDSHKETKD
KLKETTIKLTQAKEEADQIRKNCQEMIKTYQESEEIKSNELDAKLKVTKGELEKQMQEKS
DQLEMHHAKIKELEDLKRTFKEGMDELRTLRIKVKCLEDERLRTEDELSKYKEIINRQKA
EIQNLLDRVKIVEQLQDELQRGKQEIENLSEEVGSLNSLINDLQKDIEGSRKRESELLLF
TEKLTSKNAQLQSESNALQSQFDKLSCSESQLQSHCEHMRQTNTDLESRLLKEEELRKNE
SHALQAELSSRQKELKALNTQVEELKDELVTQRRKHASNLKDLTKQLQQARRKLDQIENG
NYDKEVSSMGSRSSSSGSLNARSSTEDRSPENMGSSVTVDNFPEVDKTMLIERIVRLQKA
HARKNEKIEFMEDHIKQLVEEIRKKTKIIQSYILREEAGTLSSEASDFNKVHLSRRGGIM
ASLYTSHPADSGLTLELSLEINRKLQAVLEDTLLKNITLKENLQTLGTEIERLIKHQHEL
EQRTKQT
Download sequence
Identical sequences F6RX61
ENSMODP00000012296 ENSMODP00000012296 XP_007479036.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]