SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012412 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012412
Domain Number 1 Region: 2262-2562
Classification Level Classification E-value
Superfamily BEACH domain 1.31e-127
Family BEACH domain 0.0000000000159
Further Details:      
 
Domain Number 2 Region: 208-399
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.92e-33
Family Clostridium neurotoxins, the second last domain 0.027
Further Details:      
 
Domain Number 3 Region: 2679-2932
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.33e-30
Family WD40-repeat 0.0063
Further Details:      
 
Domain Number 4 Region: 2150-2257
Classification Level Classification E-value
Superfamily PH domain-like 7.99e-30
Family PreBEACH PH-like domain 0.00000266
Further Details:      
 
Domain Number 5 Region: 491-598,677-973
Classification Level Classification E-value
Superfamily ARM repeat 2.4e-16
Family Plakophilin 1 helical region 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012412   Gene: ENSMODG00000009914   Transcript: ENSMODT00000012638
Sequence length 2945
Comment pep:novel chromosome:BROADO5:4:307669218:308509086:1 gene:ENSMODG00000009914 transcript:ENSMODT00000012638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEKPGPGPGPEPQPAGLIAVGAGAGAGGGPGGSGCGGGVSGLGELRGASSSGSMVLPA
GMINPSVPIRNIRMKFAVLIGLIQVGEVSNRDIVETVLNLLVGGEFDLEMNFIIQDAESI
TCMSELLEHCDVTCQAEIWSMFTAILRKSVRNLQTSTEVGLIEQVLLKMSTVDDMIADLL
VDMLGVLASYSITVKELKLLFSMLRGESGIWPRHAVKLLSVLNQMPQRHGPDTFFNFPGC
SAAAIALPPIAKWPYQNGFTLNTWFRMDPLNNINVDKDKPYLYCFRTSKGVGYSAHFVGN
CLIVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHIYNRWRNSEIRCYVNGQLVSYGDMAW
HVNTNDSYDKCFLGSSETADANRVFCGQLGAVYVFGEALNPAQIFAIHQLGPGYKSTFKF
KSESDIHLAEHHKQVLYDGKLASSIAFTYNAKATDAQLCLESSPKENASIFVHSPHALML
QDVKAIVTHSIHSAIHSIGGIQVLFPLFAQLDNRQLNDSQMETTVCATLLAFLVELLKSS
VAMQEQMLGGKGFLVIGYLLEKSSRVHITRAVLEQFLSFAKYLDGLSHGAPLLKQLCDHI
LFNPAIWIHTPAKVQLSLYTYLSAEFIGTATIYTTIRRVGTVLQLMHTLKYYYWVINPAD
SSGITPKGLDGPRPSQKEIISLRAFMLLFLKQLILKDRGVKEDELQSILNYLLTMHEDEN
IHDVLQLLVALMSEHPASMIPAFDQRNGIRVIYKLLASKSESIWVQALKVLGYFLKHLGH
KRKVEIMHTHSLFTLLGERLMLHTNTVTVTTYNTLYEILTEQVCTQVVHKPHPEPDSTVK
IQNPMILKVVATLLKNSTPSAELMEVRRLFLSDMIKLFSNSRENRRCLLQCSVWQDWMFS
LGYINPKNSEEQKITEMVYNIFRILLYHAIKYEWGGWRVWVDTLSIAHSKVTYEAHKEYL
AKMYEEYQRQEEENIKKGKKGNVSTISGLSSQATGTKGGMEIREIEDLSQSQSPESETDY
PVSTDARDLLMATKVSDDVLGNSDRPGGGVHVEVHDLLVDIKAEKVEATEVKLDDMDLSP
ETLVTGENGALVEVESLLDNVYSAAVEKLQNNVHGSVGMIKKSEEKDNGPLITLADEKDE
PTNNSTSFLFDKIPSQEDKLLPELSSNHIIPNVQETQVHLGVSDDLGLLAHMTSSVDLTC
TSNIIEEKEFKIHTTSDGMSSISERELVSSTKGLEYAEMTATTLETESSGNKVVPNIDAG
SIISDTERSDDGKEAGKEIRKIQTTTTTQAVQGRAITQQDRDLRVDLGFRGMPMTEEQRR
QFSPGPRTTMFRIPEFKWSPMHQRLLTDLLFALETDVHVWRSHSTKSVMDFVNSNENIIF
VHNTIHLISQMVDNIIIACGGILPLLSAATSPTTELESIEVTQGMSAETAVTFLSRLMAM
VDVLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQRQRERVNKSSLIS
SKPQEAPQSVTGAATSKTPLESVPGNLSPIKDPDRLLQDVDINRLRAVVFRDVDDSKQAQ
FLALAVVYFISVLMVSKYRDILEPQRETARSGSQAGRNIRQEINSPTSTVVVIPSIPHPS
LNHGFLAKLIPEQSFAHSFYKETPAAFQDNMKEKETPTPGEEIQLESSIPHTDSGIGEEQ
IPSILNGAELETSAGPDAMSELLSTLSSEVKKSQESLTENPNEMLKPAPSISSISQTKGI
NVKEILKSLVAAPVEIPECGPEPIPYPDPALKREAHTILPMQFHSFDRSVVVPVKKAPPG
SLAVTTVGAATAGSGLPTGSTPNIFAATGATPKSMINTTGAVDSGSSSSSSSSSFVNGAT
SKNLPAVQTVAPMPEDSAENMSITAKLERALEKVAPLLREIFVDFAPFLSRTLLGSHGQE
LLIEGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKDHIVRV
ANEAEFILNRQRAEDVHKHAEFESQCAQYAADRREEEKMCDHLISAAKHRDHVTANQLKQ
KILNILTNKHGAWGAVSHCQLHDFWRLDYWEDDLRRRRRFVRNAFGSTHAEALLKAAAEY
GTEEDVLKSKKTFRSQAVVNQNAETELMLEGDDDAVSLLQEKEIDNLAGPVVLSTPAQLI
APVVVAKGTLSITTTEIYFEVEEDDPAFKKVDPKVLAYTEGLHGKWMFSEIRAVFSRRYL
LQNTALEVFMANRTSVMFNFPDQATVKKVVYSLPRVGVGTSYGLPQARRISLATPRQLYK
SSNMTQRWQRREISNFEYLMFLNTIAGRTYNDLNQYPVFPWVLTNYESEELDLTLPGNFR
DLSKPVGALNPKRAVFYAERYETWEDDQSPPCHYSTHYSTSPSTLSWLLRIEPFTTFFLN
SNDGKFDHPDRTFSSVARSWRTSQRDTSDVKELIPEFYYLPEMFVNSNGYNLGVREDEVA
VNDVDLPPWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAVRALNVFHYL
TYEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKD
QMQQDVIMVLKFPSNSPVTHVAANTLPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGY
SLDQAHHLPIEMDPLIANNSGVNKRQITDLVDQSIQINAHCFVVTADNRYILICGFWDKS
FRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIG
DNPNSSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPE
NCLFPRLISVSSEGHCIIYYERGRFSNFSINGKLLAQMEINDSTRAILLSSDGQNLVTGG
DNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYE
HQNRY
Download sequence
Identical sequences F6R9C5
ENSMODP00000012412 ENSMODP00000012412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]