SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012436 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012436
Domain Number 1 Region: 253-296,324-510
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.24e-31
Family beta 1,4 galactosyltransferase (b4GalT1) 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000012436
Domain Number - Region: 61-125
Classification Level Classification E-value
Superfamily Prefoldin 0.0523
Family Prefoldin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012436   Gene: ENSMODG00000009932   Transcript: ENSMODT00000012662
Sequence length 525
Comment pep:novel chromosome:BROADO5:1:579280492:579380898:1 gene:ENSMODG00000009932 transcript:ENSMODT00000012662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMMVRRGLLAWISRVVLLLLLLCCAVSVLYMLACTPKGDEEQLALPRANGPTGKAGYQAI
LQEQEEQHRSYISSLKKQIAQLKDELQERSEQLKNAQSRSGDSGGHPEKTQADLLEFLHS
QVDKAEVHAGVKLATEYAAVPFDSFTLQKVYQLEMGLTRHPEEKPVRKDKRDELVEAIEL
ALETLNHPEEESNSNHRPYAASDFIEGIYRTEKDKGTLYELTFKGDQKHEFKRLVLFRPF
GPIMKVKNEKLNMANTLINVIVPLAKRVDKFRQFMQNFREMCIQQDGRVHLTVVYFGKEQ
MSEVKGILENTSKAANFKNFTFIQLSGEFSRGKGLDVGARVWKGSNVLLFFCDVDIYFTS
EFLNTCRLNTQPGKKVFYPVLFSQYNPGIIYGHHDSVPPLEQQLVIKKETGFWRDFGFGM
TCQYRSDFINIGGFDLDIKGWGGEDVHLYRKYLHSNLIVVRTPVRGLFHLWHEKQCVDEL
TPEQYKMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKTSSQKT
Download sequence
Identical sequences F6R8K7
13616.ENSMODP00000012436 XP_001373278.2.35504 XP_007476489.1.35504 XP_007476490.1.35504 XP_007476491.1.35504 XP_007476492.1.35504 ENSMODP00000012436 ENSMODP00000012436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]