SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012598 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012598
Domain Number 1 Region: 23-223
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-41
Family Pentraxin (pentaxin) 0.000000413
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012598   Gene: ENSMODG00000010057   Transcript: ENSMODT00000012826
Sequence length 224
Comment pep:known chromosome:BROADO5:2:166331119:166332183:1 gene:ENSMODG00000010057 transcript:ENSMODT00000012826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMEKLPLCFLVIMSLSHALAQTDLSGKAFVFPKQSEDSYVTLIPHLEKSLNAFTVCLKV
YTELTRKYTLFSFATQTLDNEILLFEGNSKYSLSVGNVAVVFQVPAVTFEPRHFCASWES
ESGIAELWVDGKPMGRKSLKMGYVVGKQSKIILGQEQDSFGGGFDEKQSLVGDIGDIVMW
DFALSPEEISNVYIGGTFSPNVLDWRGLNFEKKGYVVIKPKLWI
Download sequence
Identical sequences F6TCT6
ENSMODP00000012598 ENSMODP00000012598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]