SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012604 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012604
Domain Number 1 Region: 11-163
Classification Level Classification E-value
Superfamily Hook domain 5.36e-56
Family Hook domain 0.00000112
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000012604
Domain Number - Region: 519-605
Classification Level Classification E-value
Superfamily t-snare proteins 0.0141
Family t-snare proteins 0.013
Further Details:      
 
Domain Number - Region: 248-330
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0157
Family Myosin rod fragments 0.0037
Further Details:      
 
Domain Number - Region: 310-412
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0262
Family Myosin rod fragments 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012604   Gene: ENSMODG00000010062   Transcript: ENSMODT00000012833
Sequence length 718
Comment pep:novel chromosome:BROADO5:1:578471401:578588948:1 gene:ENSMODG00000010062 transcript:ENSMODT00000012833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFIVESLERVELCESLLTWIQTFNVEAACQTVEDLTNGVVMAQVLQKIDPVYFDENWLNR
IKTEVGDNWRLKISNLKKILKGILDYNHEILGQQINDFTLPDVNLIAEHSDAAELGRMLQ
LILGCAVNCEQKQEYIQAIMVMEESVQHVVMTAIQELMSKESPVSLGNDAYVDLDRQLKK
TTEELNEALAAKEEIAQRCHELDMQVAALQEEKSSLLAENQVLMERLNQSDSIEDPNSPA
GRRHLQLQTQLEQLQEETFRLEAAKDDYRIRCEELDKEISELRQQNEELTTLADEAQSLK
DEIDVLRHSSDKVAKLEGQVESYKKKLEDLGDLRRQVKLLEEKNTMYMQNTVSLEEELRK
ANAARSQLETYKRQVVELQNRLSEESKKADKLDFEYKRLKEKVDSLQKEKDRLRTERDSL
KETIEELRCVQAQEGQLTTPGLMPLGSQESSDSLAAEIITPEIKEKLIRLQHENKMLKLN
QEGSDNERIALLQSLLDDANLRKNELETENRLVNQRLLEVQSQVEELQKSLQEQGSKAED
SVLLKKKLEEHLEKLHEANNELQKKRAIIEDLEPRYNNSSIKIEELQEVLRKKEEEMKQM
EERYKKYLEKAKSVIRTLDPKQNQGAAPEIQALKNQLQERDRMFLSLEKEYEKTRSQREM
EEKFIVSAWYNMGMTLHKKAAEDRLASTGSGQSFLARQRQATSARRSYPGHVQPATAR
Download sequence
Identical sequences F6Y567
XP_001373206.1.35504 ENSMODP00000012604 13616.ENSMODP00000012604 ENSMODP00000012604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]