SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012614 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012614
Domain Number 1 Region: 21-221
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-39
Family Pentraxin (pentaxin) 0.000000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012614   Gene: ENSMODG00000010073   Transcript: ENSMODT00000012843
Sequence length 223
Comment pep:novel chromosome:BROADO5:2:166539782:166543570:-1 gene:ENSMODG00000010073 transcript:ENSMODT00000012843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERILSVILILHGLLGAIAQTDMSQQVMVFPKESSDAHVLLIPQEKKPLKNLTVCLRAYT
ELTRAYSLFSYSTKGKDNELLLFKSKVEEYNLFIGNEKVSFRALLDFGSPVHVCASWESA
SGIAELWINGKPLVRKGLKKGYSLGAEPKIVLGQDQDSFGGSFDMQQSFVGEIGDIGMWD
FVLSPHQINSLYRGETLNANILNWKALDYEIKGYVVIKPQVWS
Download sequence
Identical sequences F6XNA9
ENSMODP00000012614 XP_001369849.1.35504 ENSMODP00000012614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]