SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012778 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012778
Domain Number 1 Region: 31-493
Classification Level Classification E-value
Superfamily Cytochrome P450 2.88e-132
Family Cytochrome P450 0.0000000000317
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012778   Gene: ENSMODG00000010204   Transcript: ENSMODT00000013013
Sequence length 493
Comment pep:novel chromosome:BROADO5:1:17173083:17199563:1 gene:ENSMODG00000010204 transcript:ENSMODT00000013013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPWALTTFFLVVCVSFLVFLSLWRKDYKGRNLPPGPFPLPIIGNLLQLGHNLSMSLCKL
SEKYGPVYTVYFGPQPVVVLHGYKALKEALTDQGDIFGERGHLPIIDDIYRGQGIVFSHG
EKWKQIRRFSLMTLRNFGMGKRSIEERVQEEAQFLLEELRKTNSQPFDPTFILGCAPCNV
ISSILFHQRFNYDDEEFLSMLRILNENVTLLNTPMAQLYNNFPWFLHYFPGPHKNFFSNV
KKLREFILKNAKKYQQTLDPNNLKNYIDCFLHKMQQDQKNPDSVFDLENLATAGMDLFDA
GTETTSTTLRYGLLLILKYPEVQNKIHEEIDQVIGRHRIPSIKDKLEMPYTEAVLHEILR
FVDLVPFSLPHEVTHDTQLQQHFIPKGTTVYPLLSSVLYDAKEFPNPKEFDPRHFLNKDG
SFKKSDYFVPFSIGKRACLGEGLAKMELFIFLATILQNFTLKSVIDSKEIDIKPGSTGLL
NVPPKYQLCLLPR
Download sequence
Identical sequences F6SAU5
ENSMODP00000012778 XP_001378600.1.35504 ENSMODP00000012778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]