SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012802 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012802
Domain Number 1 Region: 41-68
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000102
Family Ran binding protein zinc finger-like 0.0032
Further Details:      
 
Domain Number 2 Region: 186-213
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000602
Family Ran binding protein zinc finger-like 0.0036
Further Details:      
 
Domain Number 3 Region: 122-148
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000889
Family Ran binding protein zinc finger-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012802   Gene: ENSMODG00000010224   Transcript: ENSMODT00000013037
Sequence length 746
Comment pep:novel chromosome:BROADO5:1:26236020:26328779:1 gene:ENSMODG00000010224 transcript:ENSMODT00000013037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKVEPQARQLIRALLWASRSSRVSFLPDIIHFKKCTMSERGIKWACEYCTYENWPSAIK
CTMCRAQRPSGTIITEDPFKSGSSDVGRDWDPSGTEGGSSPLICPDSSARPRVKSSYTVE
NANKWSCHMCTYLNWPRAIRCTQCLSQRRTRSPTESPQSSGSGSRPVPFSVDPCEEYNDR
NKLNTRTQHWTCSVCTYENWAKARKCVVCDHPRPNNIEAIELAETEEASSLINEQDRTRW
RGGSCSGGNGQRRSPPIPQRDSEMNMDFQRIELAGAVGSKEELEVDFKKLKQIKNRMKKT
DWLFLNACVGVVEGDLAAIEAYKSSGGDIARQLTADEVRLLNRPSAFDVGYTLVHLAIRF
QRQDMLAILLTEVSQHAAKCIPAMVCPELTEQIRREIAASLHQRKGDFACYFLTDLVTFT
LPADIEDLPPTVQEKLFDEVLDRDVQKELEEESPIINWSLELATRLDSRLYALWNRTAGD
CLLDSVLQATWGIYDKDSVLRKALHDSLHDCSHWFYTRWKEWESWYSQSFGLHFSLREEQ
WQEDWAFILSLASQPGASLEQTHIFVLAHILRRPIIVYGVKYYKSFRGETLGYTRFQGVY
LPLLWEQSFCWKSPIALGYTRGHFSALVAMENDGYGNRGAGANLNTDDDVTVTFLPLVDS
ERKLLHIHFLSAQELGNEEQQEKLLREWLDCCVTEGGVLVAMQKSSRRRNHPLVTQMVEK
WLDRYRQIRPCTSLSDGEEDEDEEDE
Download sequence
Identical sequences F6WLZ5
ENSMODP00000012802 ENSMODP00000012802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]