SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012804 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012804
Domain Number 1 Region: 295-558
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.42e-80
Family Eukaryotic proteases 0.0000000292
Further Details:      
 
Domain Number 2 Region: 102-207
Classification Level Classification E-value
Superfamily Kringle-like 8.22e-34
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 3 Region: 209-296
Classification Level Classification E-value
Superfamily Kringle-like 4.59e-29
Family Kringle modules 0.0000921
Further Details:      
 
Domain Number 4 Region: 32-80
Classification Level Classification E-value
Superfamily FnI-like domain 6.91e-20
Family Fibronectin type I module 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012804   Gene: ENSMODG00000010225   Transcript: ENSMODT00000013039
Sequence length 562
Comment pep:novel chromosome:BROADO5:1:577658851:577680567:-1 gene:ENSMODG00000010225 transcript:ENSMODT00000013039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGKFFGFLLICGVVSLSSQGFHNRFKRGARSYRVTCKDEKTQMIYQQKQSWLRPGLRGN
RVEYCRCDSGFIRCHSVPVQNCSEPRCFNGGTCKQALYFPDFICHCPRGFAGKQCEIDSN
SLCYEDSGFTYRGTWSTSESGAECVNWNMSAIHSKPYNGRRPDALKLGLGNHNYCRNPDQ
DSKPWCYVFKKGFYTWEYCSISLCSKSATEDCYSGNGTDYWGTQGKTVSGTPCLKWNSSR
LKSKLYTAWKKNARDLGLGNHNFCRNPDGDTKPWCHVLRGSQLTWEFCDVPKCSTCGLRQ
YKESQFRIKGGLYTDITSHPWQAAIRAINRRSPGTTRFLCGGILIDSCWVLSAAHCFQET
LKAHDLKVVLGRTSREDKEENEQEFEVEKYIIHEKFVPATFDNDIALLQLRSNSGSLQCA
QETASVRTVCLPEAGLQLPTWTECELSGYGKHEETSPYYSERLKEAHVRLYPASRCTPRQ
LSNKIVTENMLCAGDTRSGGENVNLHDACQGDSGGPLVCMKDDRMHLIGIVSWGIGCGEK
DVPGVYTKVINYLKWIEDKRRL
Download sequence
Identical sequences F6WLY7
XP_007476457.1.35504 ENSMODP00000012804 ENSMODP00000012804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]