SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012841 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012841
Domain Number 1 Region: 31-492
Classification Level Classification E-value
Superfamily Cytochrome P450 1.13e-118
Family Cytochrome P450 0.0000000000965
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012841   Gene: ENSMODG00000010247   Transcript: ENSMODT00000013076
Sequence length 493
Comment pep:novel chromosome:BROADO5:1:17152086:17167266:1 gene:ENSMODG00000010247 transcript:ENSMODT00000013076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFLGATLALLVWFVFLLFVSVWKQIQSSWKLPPGPFPLPIIGNLFTLDIRNFPKSFAKL
AKEYGPVFTVYVGSRRIVVLHGYKVVKEALLDLKNEFAGRADIPAFEAHQNSGIIFNDSE
TWRDTRRFGLTVLRDYGMGKQSNEERIQRESHFLVEALRNTNSQPFDPTFVLGGGPLNVI
HDILFHSRLDYSDKMCQRLLHLYNEDFYLLSSPWIQVYNNIGSYLRYLPGSHRKLLKNIS
EAKQYVFEKVKEHQEVVDLNHPYDLTDTLLIQMEKDQKKKKLGFNLENVTVTVADLLFAG
TETTSTTLRYGLLLLLKHPKVEEKLHEEIDRVIGPHRLPSMKDKINMPYMEAVVHEIQRV
INLVPSNLPHVMHEDIHFRGYLLPKGTTVYPTLDSVMLDSEEFPNPEQFDPGHFLNENGK
FRYSDYFKAFSAGKRVCVGEGLARMEIFLFLTIILQHFNLKPLISPEKIDTSPLTVGFGT
IPPIYKLCVLPRS
Download sequence
Identical sequences F6W669
ENSMODP00000012841 ENSMODP00000012841 XP_001364901.1.35504 13616.ENSMODP00000012841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]