SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012902 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012902
Domain Number 1 Region: 313-487
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-52
Family SPRY domain 0.0000384
Further Details:      
 
Domain Number 2 Region: 37-149
Classification Level Classification E-value
Superfamily Immunoglobulin 1.26e-17
Family V set domains (antibody variable domain-like) 0.00023
Further Details:      
 
Domain Number 3 Region: 160-235
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000103
Family C2 set domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012902   Gene: ENSMODG00000010295   Transcript: ENSMODT00000013138
Sequence length 490
Comment pep:novel chromosome:BROADO5:1:336880946:336905187:1 gene:ENSMODG00000010295 transcript:ENSMODT00000013138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNVLALLCPIQVFHNFEHHFLLISILSLIELASGQFQVIGPNNPIQALIGEDVLFSCHI
SPKMNVKNMEVRFFRNQFSSVLLLYKDGKEIDERQMQEYQGRTQFMQDAITEGTVSLKLK
NIVSSDMAKYGCWFSSKTFYEEYTWELQVVALGSTPLISLEGNRDGGILLVCQSSGWLPQ
PKIQWRYDPDQYLLLNYTVNQDDHGLFSIKTTLTIKEHSNKNISCLVLNLALGQMKESRL
QIAGEVSPLSCPLNRCIQAVAFPWFLFLLFCTRPFLFLGDFISQCHLISALLFLELMEKL
KEAGKRTTFLSFQILLLHSLEVTLDPDTAHHKLHVSEDQKSVTHEDGVIYEDNGLENNIR
FQFPCVMASQSFSSGKHYWEVEVGKMKKWYLGVCWNDVTREKEKVMFSPDKGYWILGLWN
KSEYFTYTPYRKALRFSVEPHRVGVFINYEAKEISFFNVNDRSHIYTFTNCDFKGKALYP
CFCPHKSDSP
Download sequence
Identical sequences F6SSL4
ENSMODP00000012902 ENSMODP00000012902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]