SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012903 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012903
Domain Number 1 Region: 314-408
Classification Level Classification E-value
Superfamily Immunoglobulin 8.71e-17
Family I set domains 0.02
Further Details:      
 
Domain Number 2 Region: 156-207
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000131
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 3 Region: 233-304
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000314
Family Carboxypeptidase regulatory domain 0.093
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000012903
Domain Number - Region: 498-557
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0018
Family Carboxypeptidase regulatory domain 0.056
Further Details:      
 
Domain Number - Region: 58-182
Classification Level Classification E-value
Superfamily Vitelline membrane outer protein-I (VMO-I) 0.017
Family Vitelline membrane outer protein-I (VMO-I) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012903   Gene: ENSMODG00000010296   Transcript: ENSMODT00000013139
Sequence length 1188
Comment pep:novel chromosome:BROADO5:1:151079047:151104142:-1 gene:ENSMODG00000010296 transcript:ENSMODT00000013139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVVKAWGFSLLILEVTFALASAAGPGMRQMVLSQSVRRVQPGKRNLHTLAKPADPEDSP
GEWTTWFNIDHPGGQGDYERLDAIRFYYGDRVCSRPLRLEARTTEWTTVAQTGQRVHSSP
HEGFWCINKEQLPGKNCSNYTVRFFCPPGSLRRETERIWSPWSQWSDCSASCGHTGVQTR
TRSCMVEMPWLCSEATEEGRLCVSQACSDCDMSCTMGQVNADCDACMCEDFVLHGTISQP
GGSPAPGATVHLLTKTVKPLTQTDSTGRFRIPGLCPDGKTVLKITKAKFAPIVLTMPKTS
KKMTTVSAEFARAEPPYIVKNPETKARKTGQSVSFCCKATGKPSPEKYFWYHNNTLLDPS
LYKYESNLILKNLQKKQAGEYFCKAQSDAGAVKSQIAQLTVIAPNESPCNPTPESYFIQL
PHDCFQNATNSFYYDVGRCPIKTCAGQHDNGLRCKDATESCCGTSKMEEREIECSGYTLP
TKVATECSCQKCTETKSIIRGRVSAADNGEPMRFGHVYMGNNRVSMTGYKGTFTLHVPQD
TERLVLTFVDRLQKFVNTTKVLPFNKKGSAVFHEIKMLRKKAPVTLESTETNIIPLGEVD
GEDPMAELEFPSNSFYRQNGEPYRGKVKASVTFLDPRNISTATATQSDLNFINNEGDMFP
LRTYGMFSVDFTDEAATESLNAGKVKVHLDSAQVKMPEHVPTMKLWSLNPDTGLWEEEGD
FKFENKKRNKREERTFLVGNMEIRERRLFNLDVPESRRCYIKVRAYRSERFLPSEQVQGV
VVSVINLEPKSGFSSNPRAWGRFDSVITGPNGACLPAFCDDQSPDAYSAYVLASLGGEEL
EAVESSPKFNPNAIGVPQPYLNKLKYRRTDHDDPKVKKTAFQINMAKPRPNTAEESNGPI
YTFDNLRECEEAPYSAPHFRFYRVEGDRYDYNTVPFNEDDPMSWTEDYLTWWPKPMEFRA
CYIKVKIVGPLEVNVRSRNMGGTHRQTVGKLYGIRDVKSTRDRDQPNVSSACVEFKCSGM
LYDQDRVDRTLVKIIPQGSCHRASVNSMLHEYLVNHLPLAVNNDTSEYTMLAPLDPLGHN
YGIYTVTDQDPRTAKEIALGRCFDGTSDGSSRVMKSNVGVALTFNCAERQVGRQSAFQYL
QSPPARATAGSLRGRVVGRRQERESQPGQRRRISLRLPGRAPQRPLNN
Download sequence
Identical sequences F6SSK8
XP_016279514.1.35504 ENSMODP00000012903 ENSMODP00000012903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]