SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012957 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012957
Domain Number 1 Region: 247-445
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.82e-45
Family Reprolysin-like 0.00035
Further Details:      
 
Domain Number 2 Region: 462-538
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 6.71e-19
Family Blood coagulation inhibitor (disintegrin) 0.00044
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000012957
Domain Number - Region: 694-722
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0686
Family Integrin beta EGF-like domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012957   Gene: ENSMODG00000010338   Transcript: ENSMODT00000013194
Sequence length 915
Comment pep:novel chromosome:BROADO5:8:260114278:260372830:1 gene:ENSMODG00000010338 transcript:ENSMODT00000013194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAAEAAEAAALLPWLLLGISGIFPLALCRLPGDALLTELERRNENRFLERENTVPLRLI
YRSGGEDQTRHDVLTTRIRGAPAGGGAGGRQSTHVDQASFQVDAFGSTFILDVVLNHDLL
SSEYLERHIDHGGKIVEVKGGEHCYYHGHIRGYPDSFVALSTCHGLHGMFYDGNHTYLIE
PEENDTSQEDFHFHSVYKSKLFEFPLDDLPSEFQQMNITSPKFIVKPRLKRSKRQLRRHP
RNVEEETKYVELMIVNDHLMFKKHRLSVMHTNTYAKSVVNMADLIYKEQLKTRIVLVAME
TWAADNKFTISEKPLTTLREFMKYRKDFIKEKSDAVHLFSGSRFESSRSGAAYIGGICSL
LKGGGVNEFGKTDLMAVTLAQSLAYNLGIFSDKRKLVSGECKCEDTWSGCIMGDTGYYLP
KKFSQCNVDEYHDFLNNGGGACLFNKPSKLLDPPECGNGFIETGEECDCGTLAECAREGA
DCCKKCTLTEDSQCSDGLCCKKCKFQPMGTVCREAVNDCDIQETCTGNSSQCAPNIHKMD
GYSCDNFQGICFGGRCKTRDRQCKYIWGQNVTASDKYCYEKLNIEGTEKGNCGRDKDTWI
QCNKQDVLCGYLLCTNIGNIPRLGELDGEITSSLVVQQGRTLNCSGGHVKLEEEIDLGYV
EDGTPCGPEMMCLERRCLPTASFNFSTCLSKKENAICSGHGVCSNEIKCVCNKHWSGADC
NTYLPYNDGSKSDISLSGNGVAGTNIIIGIITGTILVLVLILGIAAWGYKNYREQRQLPQ
GDYVKKPGDADSFYSDMPPGVSTNSASSSKKRSNGLSHSWSERIPDTKHISDICENGRPR
SNSWQGNLGGNRKKVRGKRFRPRSNSTETLSPAKSPSSSTGSIASSRKYPYPMPPLPDEE
KKANRQSARLWETSI
Download sequence
Identical sequences F6S926
ENSMODP00000012957 ENSMODP00000012957 XP_007505033.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]