SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013080 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013080
Domain Number 1 Region: 363-765
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.3e-133
Family Ankyrin repeat 0.000000000000485
Further Details:      
 
Domain Number 2 Region: 5-381
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.71e-115
Family Ankyrin repeat 0.000000185
Further Details:      
 
Domain Number 3 Region: 1340-1428
Classification Level Classification E-value
Superfamily DEATH domain 8.41e-23
Family DEATH domain, DD 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013080   Gene: ENSMODG00000010432   Transcript: ENSMODT00000013318
Sequence length 1656
Comment pep:novel chromosome:BROADO5:1:576983928:577072294:-1 gene:ENSMODG00000010432 transcript:ENSMODT00000013318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNGLNGLHLASKEGHVKMVVELLHKEIVLETTTKKGNTALHIAALAGQDEVVRELVNYGA
NVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAH
LINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVA
QLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAEIETRTKDELTPLHCAARN
GHVRISELLLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPL
HVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTE
SGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAK
VNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHITAREGHVETALAL
LEKEASQACMTKKGFTPLHVAAKYGKVNVAELLLERDAHPNAAGKNGLTPLHVAVHHNNL
EIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQMELASNLLQYGGSANAESVQGVTPLHLA
AQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVAVADVLVKQGVTVDATTRMGY
TPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYTPLHQAAQQGHTDIVTLLLKNGASPNE
VSSNGTTPLAIAKRLGYISVTDVLKIVTDETSVVLVSDKHRMSFPETVDEILDVSEDEGE
ELMGSKPERPDSRDADEEKELLDFVPKLDQVVESPAIPRIPCVTPETVVIRAEEPEQASK
EFDEDSLIPSSPATETSDNISPVASPVHTGFLVSFMVDARGGSMRGSRHNGLRVIIPPRA
CAAPTRITCRLVKPQKLTTPPPLAEEEGLASRIIALGPTGAQFLSPVIVEIPHFASHGRG
DRELVVLRSENGSMWKEHRSRYGESYLDQALNGMDEELESLEELEKKRVCRIVTTDFPLY
FVVMSRLCQDFDMIEPEGGSLKSKLVPMVQATFPETAVTKKVKLALQQSQSIDDVLFSMF
SMNPRKFLPSLAIRQMIVIMPALLLPLKDWEDRLKFYDENPLREVRIIVQMPGIIDGKFY
HPQSSTCDLTRYLPTLRENQCLTYTTSNTKRQFATPLYHIISAKCYSMAVIILIKVIGIP
KDCSVSCLPPSPIKKKIAQRKRETSNRVLEGMPLFAELSGNLVPVKKAAQQRSFHFQSFR
ENRLAIPVKVRDSSREAGGSLSFLRKAMKYEDSQHILCHLNITMPPCTKGSGADERRRTL
TPLALRERYSLLSESTLGSLSGTDRADMKMVIISEHLGLSWAELARELQFGVEDINRIRV
ENPNSLLEQSSALLNLWVIREGKNAKMENLYTALRNIDRSEIVNMLEGSGRQSRSLKPDR
RYPDRDYSLSPSQMNGELHGEKGTRATPSMTLGFQEQRKGERHHRSKLDMSATSSWKGGG
QKDSSSRMGGHPGSSRGPCHLLEAPQLPSSSSRPSLWPPSKPKSPPRRATEGEPHLQAPG
AERRVQKRGGTFLGISDFDLSGNELQDIPGEHVTEEQFTDEQGNIVTKKIIRKVVRQIDT
SGDRATQELDEVNTEGSLQEPSELEADIADFMKHAK
Download sequence
Identical sequences F6YT29
ENSMODP00000013080 ENSMODP00000013080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]