SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013104 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013104
Domain Number 1 Region: 19-379
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.04e-85
Family Ankyrin repeat 0.00000714
Further Details:      
 
Domain Number 2 Region: 399-502
Classification Level Classification E-value
Superfamily DEATH domain 8.24e-20
Family DEATH domain, DD 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013104   Gene: ENSMODG00000010452   Transcript: ENSMODT00000013343
Sequence length 508
Comment pep:novel chromosome:BROADO5:1:150705455:150752813:1 gene:ENSMODG00000010452 transcript:ENSMODT00000013343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEQLALENDCLLPLERQFHEAARRNNVGRMKELIAMGVNIRAKNNAGRMALHWASGAGH
EQAVRLLLEYEVSVDDKDMFGMNALLLSAWFGHLQILQMLVNSGAKINCEDKNGLNILHF
AAQKGHVHVLEFIMEDLEDVPLDRIDKLDRTAFHLAAEHGQLDTLDFLIGSGCDHGIKDK
AGNTALHLAAKSGHSAVLQRIIEIGLDLEEKNAEGFTALHMAAEGGHLDCVQRLIQAGSK
VNAQTQKQMNCLHYAALHGFDDIAQVLIDAGISVDAVNHQSACPIHIAVLNNFPSLVKLL
IKAEINLDVTDNRHQTPLHIAAENSRQDIAEMILIAGVNLNLTDKQGKTSLDVAARSNHV
SLADMIIKADRFYKWEQDNLRTDPDSWAMKPLTFKQDHGVETQHIRSVMWRLATKYLKHN
DWKKLAHYWKFTDAHIRAIEQQWTGTKSYREHGHRMLLIWLHGVIMAAENPNKGLYEGLV
GIGRRDLAESIRKKANADSNSSKKCTAM
Download sequence
Identical sequences F7F7S7
ENSMODP00000013104 XP_007479632.1.35504 ENSMODP00000013104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]