SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013134 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013134
Domain Number 1 Region: 32-289
Classification Level Classification E-value
Superfamily ClpP/crotonase 6.69e-86
Family Crotonase-like 0.00000000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013134   Gene: ENSMODG00000010481   Transcript: ENSMODT00000013374
Sequence length 290
Comment pep:novel chromosome:BROADO5:1:16372528:16395040:-1 gene:ENSMODG00000010481 transcript:ENSMODT00000013374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLSTLLFRGPALLRSCPRLSAARNYAAGGNFEYIVTEKKGKNNNVGLIQLNRPKALNA
LCEGLIKEINQALMTFQEDPSIGAIVLTGSEKAFAAGADIKEMQDKTFQACYSGTLLKDW
DRITQLKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILIGTIPGAGGTQRLT
RIVGKSLAMEMVLTGDRISAQEAKQAGLISKIFPVDKLVEEAILCAEKIANNSKIVTEMA
KESVNAAYETTLAEGIKMEKKLFYSTFATEDRKEGMTAFVEKRKPNFKDK
Download sequence
Identical sequences F7ESK8
XP_007478154.1.35504 ENSMODP00000013134 ENSMODP00000013134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]