SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013290 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013290
Domain Number 1 Region: 80-472
Classification Level Classification E-value
Superfamily Cytochrome P450 3.67e-85
Family Cytochrome P450 0.00000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013290   Gene: ENSMODG00000010610   Transcript: ENSMODT00000013534
Sequence length 494
Comment pep:novel chromosome:BROADO5:8:264522198:264535698:-1 gene:ENSMODG00000010610 transcript:ENSMODT00000013534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARASRSLWCAVAAATAGSAAAAAAGMALLGMLEGAAEAVGGGRLSAVLAAFVCTLSLA
YLLRRGLGLLQGPEQLPREAKCPPYIFSPIPFLGHAIAFGKSPIEFLENAYEKYGPVFSF
TMVGKKFTYLLGSEAAALLFNSKNEDLNAEDVYGRLTTPVFGKGVAYDVPNPVFLEQKKM
LKTGLNIAQFKQHVSIIEKETKEYFESWGESGEKNLFEALSELIILTASHCLHGKEIRSQ
LNEKVAQLYADLDGGFTHAAWLLPGWLPLPSFRRRDRAHQAIKSIFHNAIQKRRESKEKY
DDFLQTLLDSTYKDGRSLTDDEIAGLLIGLLLAGQHTSSTTSAWMGFFLARDKTLQEKCY
LEQRSVCGEDLPPLHYDQLKDLHMLDRCLKETLRLRPPIMTMMRLAKTPQMVAGYTIPPG
HQVCVSPTVNHRLKDSWRERLDFNPDRYLQENPASGEKFAYVPFGAGRHRCIVNYTTMIH
TPHNPIIRYKRRTI
Download sequence
Identical sequences F7G822
ENSMODP00000013290 ENSMODP00000013290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]