SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013304 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013304
Domain Number 1 Region: 293-620
Classification Level Classification E-value
Superfamily L domain-like 8.84e-65
Family Internalin LRR domain 0.012
Further Details:      
 
Domain Number 2 Region: 29-330
Classification Level Classification E-value
Superfamily L domain-like 1.02e-54
Family Internalin LRR domain 0.0058
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000013304
Domain Number - Region: 644-714
Classification Level Classification E-value
Superfamily DEATH domain 0.00706
Family DEATH domain, DD 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013304   Gene: ENSMODG00000010621   Transcript: ENSMODT00000013549
Sequence length 739
Comment pep:novel chromosome:BROADO5:8:264540928:264563472:-1 gene:ENSMODG00000010621 transcript:ENSMODT00000013549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTPQTSIDSNKRILRYESYTGNEEFQVKMNSKNLQDFPQSLFKTQEVKYLYLDKNKIKTF
EVEPDMVGLEILSMKENELIALPPEINMLCNLSVLSVSHNQLASLPAQLSQLVKLRQLFL
DYNNFWEFPAILERLTMLELLSLSGNYLQVLPQTTANMKNLKILNLSSNQFSIFPNILCY
LSKLVKLRISKNFISSLPKEIKQLKNLEELFLDHNQLTFLPVQIFRLIKLRKLDLVHNKL
DILSHNIENFKDLKALLLDNNLLKNLGKEIYSCAQLEYLSLNDNFLEKIPNNIYRLKNLR
ELHINRNKMTVLSEDISHLKYIRVLNFSGNIIKEVPVELKNCSQMRKVDLSFNKIYSFPV
GLCALSFLEYLNLNGNELSEIPVDLSYSKQLIHLELNQNDFAYFSHHICKLKNLNFLNLS
KNKIHHIPSSISNMTSLQVLLLSDNKFEIFPQELCTLGNLQILDISENQVQFIPSEISNL
QVIQKLDISSNRFESFPNELCQLSTLTELKLCQKNGWKLNQVSEELTNLIHLKILDISHN
NIKEIPKNIGELKRLATFNASNNLIHILPPSFGSLNKLQQLDMSENRLTTLPTNLSSLPS
LKEINFDGNPLIRPPPEVCRGKDLNVIGHYLEKADDRDEKILLKIFKMISQNLNKGDFEF
FCEKLQLKKPVIEVLLKKTATKLPEAILEALNIWKVEKDPPLTAAVLRDQLIRIIALTGI
LELSDRATALKLSTRAFKF
Download sequence
Identical sequences F7DPB1
ENSMODP00000013304 13616.ENSMODP00000013304 ENSMODP00000013304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]