SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013327 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013327
Domain Number 1 Region: 88-227
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000113
Family Canonical RBD 0.0083
Further Details:      
 
Domain Number 2 Region: 305-411
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000113
Family Canonical RBD 0.0064
Further Details:      
 
Domain Number 3 Region: 235-263
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000112
Family Ran binding protein zinc finger-like 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000013327
Domain Number - Region: 772-830
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00159
Family Classic zinc finger, C2H2 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013327   Gene: ENSMODG00000010640   Transcript: ENSMODT00000013572
Sequence length 878
Comment pep:known chromosome:BROADO5:X:71778916:71793990:1 gene:ENSMODG00000010640 transcript:ENSMODT00000013572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLAEHGGSSRAGGSWEVRRSHRPRSRPPPDMEYERRGGRGDRTGRYGATDRSLQDDGLDS
RSQRDHDYRDMDYRSYPRDFNSQEPRHDYDDSSEEQSAEDSYEASSGSETQQRKRDSPTE
PLGFPGDGDYRDQDYRTEQGEEEEEEKASHIIMLRMLPQAAAENDIRAQLQSHGIQAREV
RLMRNKSSGQSRGFAFVEFSHLQDAARWMEANQHSLSILGQKVSMHYSDPKPKINEDWLC
NKCGVQNFKRREKCFKCGVPKSEAEQKLPLGARLDPQMMPLGGRELSQGLLPLPQPYPAQ
GLLAPQALSQGSEPTSENANDTIILRNLNPHSTMDSILGALAPYAVLSSSNVRVIKDKQT
QLNRGFAFIQLSTIVEAAQLLQILQALHPPLTIDGKTINVEFAKGSKRDMASSDGSRINA
ASVASTAIAAAQWAISQASQGGEGSWAAPEEPAGEYNYYHQDETYCGPSTEATLYGHSGY
LKGATKALGVASSKGDPAAAGTEATLEPCVPGVEAVPLIQAFPRAQASTMTSVYQQPGPE
GASAQGIVPNTQPYTIVSPAVLKAELLSPAQPSSAPPPTTSPAAQDSYGQYPIPDVSTYQ
YDETSGYYYDPQTGLYYDPNSQYYYNSQSQQYLYWDGERRTYVPALEQVTDGHKETGGTL
KEGKEKKEKHKTKTAQQIAKDMERWARSLNKQKENFKNSFQPISSLREDERRESATADAG
YAILEKKGTLAERQHTTIELPKLTSDDRLSPPRGLVAAYSGESDSEEEPERNAEREERLT
DWQKLACLLCRRQFPSKEALIRHQQLSGLHKQNLEIHRRAHLSENELEALEKSDMEGLFP
LPQMKYRDRAAERREKYGIPEPPEPKKRKSGAVVAATV
Download sequence
Identical sequences F7D4U6
ENSMODP00000013327 13616.ENSMODP00000013327 ENSMODP00000013327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]