SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013437 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013437
Domain Number 1 Region: 441-566
Classification Level Classification E-value
Superfamily Cadherin-like 2.49e-27
Family Cadherin 0.0017
Further Details:      
 
Domain Number 2 Region: 236-346
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-27
Family Cadherin 0.0013
Further Details:      
 
Domain Number 3 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-24
Family Cadherin 0.0029
Further Details:      
 
Domain Number 4 Region: 340-444
Classification Level Classification E-value
Superfamily Cadherin-like 6.02e-23
Family Cadherin 0.0024
Further Details:      
 
Domain Number 5 Region: 556-663
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000286
Family Cadherin 0.0017
Further Details:      
 
Domain Number 6 Region: 31-125
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000585
Family Cadherin 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013437   Gene: ENSMODG00000010724   Transcript: ENSMODT00000013683
Sequence length 851
Comment pep:novel chromosome:BROADO5:1:333220918:333227863:1 gene:ENSMODG00000010724 transcript:ENSMODT00000013683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRKMEKNSGRALKSQVLFSFFLSLFCLALPEPIRYSIPEEMVKGSVVGNLSKHLGLEFRD
LQSRKLRISGEREYFAVSTETGELVIKERIDREQLCGKKPVCVLDFETVAENPLNFFHIT
VEIEDINDHSPQFSQDTFDLQISESTLPGARFILVSAQDADVGSNSLREYQLSPSTDFSL
VNRHNKDGNKYPELVLEKSLDRETQNSHQLFLTAVDGGDPARSSTAQIRINVTDANDNAP
VFSQDVYRVSLPENLPRGSPVLKVTATDKDELVNAEITFSFRSTGQDFWYVFDLDANSGE
ITTAESIDFEKNKDYSLVLEARDGGGLVTQCTIEIEVLDVNDNAPEVLLQSIPSVIPEDI
LPRTVIALIKTRDKDSGHNGEVSCEIKGKVPFKILSSSKNSYKLMTDGPLDRERIPEYNI
TVIATDKGNPSLSTSKILTLVVGDVNDNPPVFLLPSYVIYVPENNPSGASIGSVSASDPD
VGENGLVSYSIVRSDLDLVPGSSYVSVSDHNGDIFSQRSFDYEQVRTFEVILQACDSGSP
ALCTNTTLQVFVLDGNDNSPNILYPTLSPDSSVLFDMVPRLAEPGYLITKVVAVDADSGH
NAWLAYHVLQATDPGLFSLGLRTGEVRTARALTGRDSARHRLLVSVQDDGQPPLSATVAL
HLVFADSLQEALPEMREERTDTLDPNSELQFYLVIALALVSVLFLVTVILVIALRLRKSS
NLDEWGCFRPNLCSKSGSGPPANYSEGTLPYSYNLCVATDQGKPVFNVPKCNGPLNPGQD
LLSFDSSRSSYPPFGISDSASYPSHLIFPQPNYADILLSQHSCEKTEPLLVSEDSKCSTH
DPPLVPVSLCP
Download sequence
Identical sequences F7G7L2
13616.ENSMODP00000013437 ENSMODP00000013437 ENSMODP00000013437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]