SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013442 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013442
Domain Number 1 Region: 441-567
Classification Level Classification E-value
Superfamily Cadherin-like 4.58e-29
Family Cadherin 0.002
Further Details:      
 
Domain Number 2 Region: 236-340
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-27
Family Cadherin 0.00086
Further Details:      
 
Domain Number 3 Region: 340-444
Classification Level Classification E-value
Superfamily Cadherin-like 2.75e-25
Family Cadherin 0.0027
Further Details:      
 
Domain Number 4 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-21
Family Cadherin 0.0061
Further Details:      
 
Domain Number 5 Region: 558-668
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-17
Family Cadherin 0.00086
Further Details:      
 
Domain Number 6 Region: 29-125
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000384
Family Cadherin 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013442   Gene: ENSMODG00000010729   Transcript: ENSMODT00000013688
Sequence length 815
Comment pep:novel chromosome:BROADO5:1:333151923:333154370:1 gene:ENSMODG00000010729 transcript:ENSMODT00000013688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIAEQKRKISMPPVLLCFLLGSLWETSAAQIRYSVPEEMKKGSFVGNIAKDLGLEVRMLS
QLGARIVSRGKKQYFALNVRNGSLVIGERIDREELCTQSTQCLLNFNVLVEDTLKIYSVE
VEIIDINDNSPHFLLEELELKISETTALGTQHLLENAYDPDVGVNSLQGYELSSSDHFSL
KVHSRAKGVKYPELILERALDREDEPIHHLMLTAWDGGEPVRSGTARIRVTVLDANDNAP
VFTQPIYTVNVPENVPQGTVLLIVNATDADEGINSQVRYFLVKIPGKNSEIFQLNSVTGE
LLTLQNLDYEDAEFHEMEVEAQDGLGLRSRAKIHVTVVDVNDNAPEVTITSVTSSIPENA
PPGTIITLFHVHDRDSGKNGQVLCSIPDDLPFKLEKKVDNYHSLVTDRALDREQVSEYNI
TVTAVDFGGPPLSTDTHIFLHVADINDNPPTFSQSAYSAYIQENNPRGASIYSLTAHDPD
SQENALVTYSLVDSNLPLEAPPLSSYVSINSETGVLYALCSFDYEQSQELQLRVTARDSG
DPPLSSNVSLTLFILDQNDNAPEILYPAFPTDGSSGVELAPRSAEPGYLVTKVVAVDADS
GQNAWLSYHLLKATEPRLFSVGLHSGEIRTVRAFLDKDALKQNLLVAVTDNGEPPLSATI
SVTVAVADSIPEILSDLSSHPAPESQDDSLLTFYLVIAVAVVSCLFFTFIVLLLALRLRK
WWMLQVVQSAADHVGGVSSSQFLGIDGVRAFLQTYSHEVSLTMDSRKSQLFFPQPNYADT
LISQQSCEQKESPFPAQSLLQGKDEQTSFQVNFVL
Download sequence
Identical sequences F7G7H5
13616.ENSMODP00000013442 ENSMODP00000013442 ENSMODP00000013442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]