SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013570 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013570
Domain Number 1 Region: 41-229
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.2e-49
Family Astacin 0.00017
Further Details:      
 
Domain Number 2 Region: 236-400
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-31
Family MAM domain 0.0019
Further Details:      
 
Domain Number 3 Region: 397-557
Classification Level Classification E-value
Superfamily TRAF domain-like 7.85e-30
Family MATH domain 0.00092
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000013570
Domain Number - Region: 581-623
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000363
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013570   Gene: ENSMODG00000010835   Transcript: ENSMODT00000013819
Sequence length 675
Comment pep:novel chromosome:BROADO5:3:199879544:199915681:-1 gene:ENSMODG00000010835 transcript:ENSMODT00000013819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIDVDGGKEQDIFDINEALGQNLFEGDIYLDGRDRNSIIGDEYRWPHTIPYVLEDSLEIN
AKGVILHAFERYRLKTCIDFKPWEGEDNYISVFKGNGCYSSVGNRHVGKQALSIGTNCDR
IATVQHEFLHALGFWHEQSRSDRDDYVIIMKDRIQEGMHNFNTYDDKESDSLNVPYDYTS
VMHYSKTAFQNGTEPTIVTRIPDFLDVIGQRMDFSAYDLEKLNRLYNCSSSKTFMDSCDF
ELENVCGMIQNSEDNADWQRVSQVLGGPDTDHSNMGQCKGSGFFMHFNSSSVNVGGKALL
ESRIFYPKRGFQCLQFYYYNNGNKDDQLKIYIREYTSVNVNGSLSLVHEVKDVPTGIWEL
YYVTLAVTNKFRVVFEGTRGPGTSAGGLSIDDINLSETHCPHHIWKINNFSTLTGVLFSP
PFYSPTGYAFQVQLDISRQTNIGIYFSLISGVNDEQLQWPCPWQQATMTLLDQNPDIRQR
MSNQRSVTTDPFMTIDNGNGSLYWDKPSKVGVTATFPNGTSYFRGPHYGTSVYITHQRMQ
SRDFIKGDNVYLLLTVEDISNLINTQPTAIPSKEPATTLNSERNLCANFTCENDGVCVNH
NDKAECRCPSGKDWWYSGEKCETKGSTKDTIVIAVSSTAAVFAVMLIVTLVSVYCVKKKY
SRRSNDSTLSVTVEN
Download sequence
Identical sequences F7BDF7
ENSMODP00000013570 ENSMODP00000013570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]