SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013599 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013599
Domain Number 1 Region: 660-736
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 2.49e-29
Family AN1-like Zinc finger 0.0000103
Further Details:      
 
Domain Number 2 Region: 24-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.04e-26
Family Ubiquitin-related 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013599   Gene: ENSMODG00000010862   Transcript: ENSMODT00000013848
Sequence length 741
Comment pep:novel chromosome:BROADO5:1:14505669:14558050:1 gene:ENSMODG00000010862 transcript:ENSMODT00000013848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRANLARTGIQLSTAYPQGIGKVNLMANKKEPPFFNEDNVGPFYYKLPFYETMELFIET
LTGTCFELRVSPFETVISVKAKIQRLEGIPICQQHLIWNNMELEDDYCLNDYNISEGCTL
KLVLAMRGGPINTRRVPMEDPLREMAEYMDSSRDEVWEKASCNKQVTFLVYREGDQLNFF
RVVDRGDGTLTPLSESLSGGSVYNLYTDDDEEIEPSPSGQQIIENSITMNKMKLLKAKME
TMNLSKKPKKTVKVKPRPPMAPRPSSGSMAAARHRLLRVLPHIGQSCLPPPGNSYPAEPS
QNALSALATLATTGRPIPSITTDFLKEEDNWENTTLSQTISSIKLPAKVSHVELENAKQP
ISDTVLPLVSSLSTQTEIFSENLLSKTEEDTIFPNVELCAAEESLLPEMDAFALLAEGNV
AEQYSDLDSPEKVNRDLVLTDGDKDIKTPEQRQKPVARMLNSESMEASVLNTRELSPQKN
RLLSPLRYSAPVTHHGSLVKPQRQSKCFETGNLRTPTSQNVFRSLDVRNIADPSFPRTTR
FRGVKVDSPGKRSDIISKVEARDITEMANKACKEPVGSVNNIGFLASLARSASRDSLQSS
CGASRLRTSAIALSTNLQHFQEENLRKSSPQIEPADFFLSTHGLGMNGNNTSAGKRVGET
THHLPPVKAPVQTKKKTSKHCFLCGKKTGLATSYECRCGNNFCATHRYAETHGCTYDYKS
AGRRYLQEANPVVSAPKLPKI
Download sequence
Identical sequences F7AR16
ENSMODP00000013599 XP_003339943.1.35504 XP_007478124.1.35504 XP_007478125.1.35504 ENSMODP00000013599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]