SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013614 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013614
Domain Number 1 Region: 125-219
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 4.58e-36
Family VPS28 C-terminal domain-like 0.00027
Further Details:      
 
Domain Number 2 Region: 18-112
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 3.6e-34
Family VPS28 N-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013614   Gene: ENSMODG00000010871   Transcript: ENSMODT00000013863
Sequence length 221
Comment pep:novel chromosome:BROADO5:3:436167384:436176443:-1 gene:ENSMODG00000010871 transcript:ENSMODT00000013863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHGIPATPGMGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDC
VTPNEYTAACSRLLVQYKAAFKQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKD
DKGNLNRCIADIVSLFITVMDKLRLEIRAMDEIQPDLRELMETMNRMSHLPPDFEGRQKV
SQWLQTLSGMSAADELDDSQVRQMLFDLESAYNAFNRFLHA
Download sequence
Identical sequences F7CIV5
ENSMODP00000013500 ENSMODP00000013614 ENSMODP00000013500 ENSMODP00000013614 XP_001364777.1.35504 XP_001364846.1.35504 XP_020850697.1.61212 XP_020850698.1.61212 13616.ENSMODP00000013500 13616.ENSMODP00000013614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]