SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013615 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013615
Domain Number 1 Region: 128-375
Classification Level Classification E-value
Superfamily vWA-like 1.16e-85
Family Integrin A (or I) domain 0.00000000083
Further Details:      
 
Domain Number 2 Region: 371-461
Classification Level Classification E-value
Superfamily Integrin domains 1.88e-32
Family Integrin domains 0.00000497
Further Details:      
 
Domain Number 3 Region: 627-711
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.7e-24
Family Integrin beta tail domain 0.00000915
Further Details:      
 
Domain Number 4 Region: 24-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000146
Family Plexin repeat 0.0000899
Further Details:      
 
Domain Number 5 Region: 585-626
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000001
Family Integrin beta EGF-like domains 0.00053
Further Details:      
 
Domain Number 6 Region: 543-581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000131
Family Integrin beta EGF-like domains 0.002
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000013615
Domain Number - Region: 512-543
Classification Level Classification E-value
Superfamily EGF/Laminin 0.053
Family Integrin beta EGF-like domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013615   Gene: ENSMODG00000010872   Transcript: ENSMODT00000013864
Sequence length 784
Comment pep:novel chromosome:BROADO5:2:208074573:208158700:1 gene:ENSMODG00000010872 transcript:ENSMODT00000013864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRALCLVLLALGALEGGVQGANVCTTRGVNSCQQCLAVSPLCAWCSAEDFALGSSRCD
LKENLLKEGCDLESIEFPVSQIRILEARPLSNTGSGDSSKITQVSPQKIELRLRPDDSQT
FSVQVRQVEDYPVDIYYLMDLSNSMRDDLQKIQSLGTKLASEMRKLTSNLRIGFGAFVDK
PMSPYMYISPPEALKNPCYELKTTCLPMFGYKHVLTLTDQVTRFNEEVRKQNVSRNRDAP
EGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLSGIVQPNDGECHIGSDN
HYSASTTMDYPSLALMTEKLSQKNINLIFAVTRSVVSLYQNYSELIPGTTVGMLSGDSSN
VLQLIIDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCVGLKIGDTVSFSI
EAKVRGCPEEMEKSFTIKPVGFKDSLTVFVTFDCDCACQDQAEPHSSRCNQGNGTFECGV
CRCGPGWLGAQCECSEEDYSPSQQDECSPQEGQPACSQRGECLCGQCVCHSSDFGKVTGK
YCECDDFSCVRYRGEMCSGHGQCSCGDCLCDSDWTGDYCNCTTRTDMCMSSNGLLCSGRG
QCICGKCVCIQPGSYGDTCEKCPTCPDACTFKKECVECQKFKRGTLWEEDTCSRYCRDEI
MPVTELADTGKDAVNCTYKDENDCVVRFQYYEDSSGKSILYVVDEPDCPKGPDILVVLLS
VTGAILLIGLATLLIWKLLITIHDRREFAKFEEERARAKWDTANNPLYKEATSTFTNITY
RGNS
Download sequence
Identical sequences F7FW35
ENSMODP00000013615 ENSMODP00000013615 XP_007482585.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]