SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013697 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013697
Domain Number 1 Region: 150-287
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-25
Family Cadherin 0.00029
Further Details:      
 
Domain Number 2 Region: 268-362
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000186
Family Cadherin 0.00049
Further Details:      
 
Domain Number 3 Region: 76-162
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000214
Family Cadherin 0.00058
Further Details:      
 
Domain Number 4 Region: 391-502
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000393
Family Cadherin 0.009
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000013697
Domain Number - Region: 508-596
Classification Level Classification E-value
Superfamily Cadherin-like 0.000753
Family Cadherin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013697   Gene: ENSMODG00000010945   Transcript: ENSMODT00000013947
Sequence length 1167
Comment pep:novel chromosome:BROADO5:3:200748948:200783818:-1 gene:ENSMODG00000010945 transcript:ENSMODT00000013947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVLPAEGAWRLGALLLLICFHFGNGLHLKVLHTDNENGLISPQGNLIRQKREWITAPVS
LREGEDLSKKNPIARIHSDLAHEQNIKVTYRYTGQGITEPPFGVFVFDKITGELNVTKIL
DREEVPMYILTGYALDERGNNLERPLELRIKVLDVNDNEPVFTQDVFVGSVEELSPANTL
VMKISATDADEKNHINSQVSYKIVSQEPAQPFVFFLDKDKGEILTTAFLLDREKHSHYSL
IVEASDRSGQKTDKPVSRAKVQINILDVNDNIPVAEFEMYENTIEENQANVEVIRIKVTD
LDEVGSDNWLANFTFISGNEEGYFHVETDSQTNEGIVTLVKELDYEVLKSLDLKIIVTNK
APFHKSIRNKFKAKSIPIKIKVKNVVEGVYFQSQSIKVQTSEQMERSEIGKTIGKFQAYD
QDTGKIAHVTYAKGEDVDNWITVDPITSEIKLVKIPDYESKYVINGTYIAKIVAITKDIP
SKTVTGTIEIMVKDINDNCPELVNPVQTICDDSTYVNVTAKDLDGYPYSSPFSFAVIDKP
AGMAENWYFGHQESTSAWLIPKELKIGRSEVHLSVSDNQGLSCPEKQILTLTVCNCVSGS
GCTEPLFDPYVGLGSGAIGLMIFALLLLLLLPLLLLLCHCGGGGGGAHGFTAIPGTVEML
HPWNNEGAPPEDKVVTPLLATDAGVNFGATPGGLTRVGIISSESTKRGSSSGHHTMTVVD
GGWEEHRNLLTSGITRTVGSAGAMSGATTMGAAGAMSGATTMGAAGAMSGATTMGAAGAM
SGATTMGAAGAMSGATMLGAAGAMGAVGARTTTMALNEEYLKNYFSDKAASYVDNDEIQA
AKDCLLVYSQEDSQSLHGSIGCCSFIEGDWDDSYLDDLGIKFKMLAEICTGQKLETANEP
SPGHKLPTKASTRTASHSLYEQSTLQTEKSHSSSSGISLQASKPLSESPSETTKQELFAE
RSFSSRQGLKVGRPGPDLPPGNIVITETSYASGSTLPPSTLILNSRPPQSLVVTERVYAP
TSALVDQPLVRQREDQSNMVVTERVYAPASALVDQPLRQREDQSNMVITEVARPKGAMSG
SLGNIMDVPDSSYVVVRERESFLAPSSGLQSVMVTEGGVASTSNLQASKTASLQKNLDLQ
ESGPSHSMVTASSTRITKHSTVQHSYS
Download sequence
Identical sequences F7EP22
XP_007487267.1.35504 ENSMODP00000013697 ENSMODP00000013697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]