SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013704 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013704
Domain Number 1 Region: 695-721
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000000432
Family Ran binding protein zinc finger-like 0.00043
Further Details:      
 
Domain Number 2 Region: 823-850
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000000107
Family Ran binding protein zinc finger-like 0.001
Further Details:      
 
Domain Number 3 Region: 630-655
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000801
Family Ran binding protein zinc finger-like 0.0017
Further Details:      
 
Domain Number 4 Region: 765-792
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000314
Family Ran binding protein zinc finger-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013704   Gene: ENSMODG00000010951   Transcript: ENSMODT00000013954
Sequence length 1456
Comment pep:novel chromosome:BROADO5:3:322353609:322404927:1 gene:ENSMODG00000010951 transcript:ENSMODT00000013954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVHEESNGPGGILSRVTESVKNIVPAWLQKYFNRNETAYVHSEDNRESRHWQENTENDH
LLYTDEENPIINDGRITPDPTISNEPSTSRSALNYPDVLTRPSLHRSHLNFSMLESPTMH
CQPSTSSAFPIGSSGFSFVKEIKDSTSQHDDDNISTTSGFSSRASDKDIAVSKNTSGPPL
WSPEAERSHSLSQHTATSSKKPAFNLSAFGTLSPSLGNSSILKTSQLGDSPFYPGKTTYG
GAAAVRQSKIRNTPYQAPIRRQMKAKQVNSQSYGVTSSTARRILQSLEKMSSPLADAKRI
PAAISSPLSSPLDRSGIEIIDIPAKRKKMESHYPPVQRLMTPKPISIATSRSVYFKPSLT
PSAEGIKTSQRIDKKHNIGCEKNLSPGQKEQHESDFSYPNFSTPATNGLPSGVGGGGKMR
RERTRFVPKLPDEEEEVEAPVLPKISLPITSTSLPVFSFCSPLSTSSSLSPINATQTLSN
KIQAASPNKTGSPVFRFSSPIVKSTEADILPPTSIGFTFSVPVVKSSEISVCSNISGSTI
SSVKDATTLNSTSNNKEDGEDYEGPFRPAKTLKEGSVLDILKSPGFTSPKTGSPAAVQPT
TTNVEVYTRPAISTFSSSGPGFGETLKPGTTWQCETCLVQNKVTENKCVACQAAKASPKD
TAKPTGTMPLSNSVRSTLPTAGTFGFGDKFKPAVGTWDCDTCLVQNKPEATKCVACETPK
PGTGVKQTLTLPVTSENAVTMTTSTSSCTKATDNLGFGDKFKKPKDSWECLVCCVLNKAE
DSKCVACMSEKPGGSVPVPCNNTTPVSMPSGGFLGLDKFKKPEGSWDCEVCLVQNKAEDT
KCVACESAKPGTKSEFIGFGTSSSSSDSGAPSFKFGIPASTSESSQTFASTGSFKFGEQG
GFKLGVSSDSASSNPMSGGFKFSKTVGDFKFGVSPSDSNSEESKKDSKNDSNFNFGVPSG
VSPSPSVSFQFGSSNPGPQEKKEELNTSTTAGFKFGTSVAASLTSAASTVTITTSENKTG
VGGFSFGPTEAKNMAVTPFAFKKSEENKEETPAAKGGGFSFTSVESPCLPSASVFVMGRT
EEKQQEPVTSGTSLVFGKKADSEEPKSQQVFSFGNSEQTKDESSAKRAFSFNLTKPVENK
TEQSTKIPFAFGAQTSTAADQGAAKTVFNFLSSNSSSSNVAPPTTSAGGSMFGGVTSASN
PSVPAFMFGQASNTGTSSAFGNSTESNTSQSFVFSQESKPATTSSTGVAVGPFVFGTGAN
SNNTATSSFSFGATTSSGSAGSSSFVFGAGSSAPSASPAFGTSQTPAFGQNQGASQPNAP
GFGSLPSSTLFSTGSQPPAPAFGSVSSSSQPPVFGQPPTQQSGFGSGTTPNSSSVFHFGS
STANFNFTNNNPSGVFTFGANAGTPAASAQPSGSAVFPFNPSPAAFTVGTNGKNMFSASG
TSVSGRKIKTAVRRRK
Download sequence
Identical sequences F7BCM6
XP_007487965.1.35504 ENSMODP00000013704 ENSMODP00000013704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]