SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013730 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013730
Domain Number 1 Region: 3992-4359
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 4.71e-98
Family Regulator of chromosome condensation RCC1 0.0049
Further Details:      
 
Domain Number 2 Region: 368-734
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.74e-95
Family Regulator of chromosome condensation RCC1 0.00071
Further Details:      
 
Domain Number 3 Region: 4487-4835
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.62e-90
Family Hect, E3 ligase catalytic domain 0.0000571
Further Details:      
 
Domain Number 4 Region: 3418-3515,3572-3815
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.38e-34
Family WD40-repeat 0.0066
Further Details:      
 
Domain Number 5 Region: 2020-2202
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-34
Family SPRY domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000013730
Domain Number - Region: 2738-2800
Classification Level Classification E-value
Superfamily UBA-like 0.0221
Family UBA domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013730   Gene: ENSMODG00000010971   Transcript: ENSMODT00000013980
Sequence length 4859
Comment pep:novel chromosome:BROADO5:1:149128452:149348780:-1 gene:ENSMODG00000010971 transcript:ENSMODT00000013980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMVPPVKLKWLEHLNSSWITEDSESIATREGVSVLYSKLISNKEVVLLPQQVLCLKGP
QLPDFERESLSSDEQDHYLDALLTSQLALAKMVCSDSPFAGALRKRLLVLQRVFYALSNK
YHDKGKVKQQQHSPESNSGSTDIHSVSERPRSSTDALIEMGVRTGLSLLFALLRQSWMMP
VSGPGLSLCNDVIHTAIEVVSSLPPLSLANESKIPPMGLDCLSQVTTFLKGVTIPNSGAD
TLGRRLASELLLGLAAQRGSLRYLLEWIEMALGASAVVHTMEKNKLLPSQEGMISFDCFM
NILMQMRRSLGSSADRSQWREPTRSSDGLCSLYEAALCLFEEVCRMASDYSRTCASPDSI
QTGDAPIVSETCEVYVWGSNSSHQLVEGTQEKILQPKLAPSFSDAQTIEAGQYCTFVIST
DGSVRACGKGSYGRLGLGDSNNQSTLKKLTFEPHRSIKKVSSSKGSDGHTLAFTTEGEVF
SWGDGDYGKLGHGNSSTQKYPKLIQGPLQGKVVVCVSAGYRHSAAVTEDGELYTWGEGDF
GRLGHGDSNSRNIPTLVKDISNVGEVSCGSSHTIALSKDGRTVWSFGGGDNGKLGHGDTN
RVYKPKVIEALQGMFIRKVCAGSQSSLALTSTGQVYAWGCGACLGCGSSEATALRPKLIE
ELAATRIVDISIGDSHCLALSHDNEVYAWGNNSMGQCGQGNSTGPITKPKKVSGLDGVAI
QQISAGTSHSLAWTALPRDRQVVAWHRPYCVDLEESTFSHLRSFLERYCDKINSEIPPLP
FPSSREHHSFLKLCLKLLSNHLALALAGGVATSILGRQAGPLRNLLFRLMDSSVPDEIQE
VVIETLSVGATMLLPPLRERMELLHSLLPQGPDRWESLSKGQRMQLDIILTSLQDHTHVA
SLLGYSSPSDATDVSSICIAYGNLSDQPYGTQSCHPDTHLAEILMKTLLRNLGFYTDQAF
GELEKNSDKFLLGTSSSENSQPAHLHELLCSLQKQLLAYCHINSVSENSSSVALLHKHLQ
LLLPHATDIYSRSANLLKESPWNGSVGEKLRDVIYVSAAGSMLCQIVNSLLLLPVSVARP
LLSYLLDLLPPLDCLNRLLPAAALLEDQELQWPLHGCSFRVSPHSCPFHPCSQAVAYLRP
LCSLVPQCVSLCVQCFPGSAPLALHQFLEVVPPFLLSLFSFTPMLYKCMSCLLEVAFSGN
EEQKPFDYKLRPEIAVFVDLALGCTKEPARSLWISMQDYAISKDWDSATLSNESLLDTVS
RFVLAALLKHTNLLSQACGESRYQPGKTLAEVYRCVYKVRSRLLACKNLELIQTRSSSRD
RWLPSEQASQSTSPTTQSQNSPTNHPQSSDPSLFKQTIQVPSPPFSHLPITVHHEVMTAG
KIFQCFLSAREVARSRDRDRMNTGAGSGTRVDDQPPQSQQERRVSTDLPEGQDVYTAACN
SVIHRCALLILGVSPVIEELQKRREEGQLQQPTTSASDGVLLMTRSESLTAESRSVHASP
NYRLIKSRSESDLSQPESDEEGYSLSGRRNVDLDLPSSHRKRGPVHSQMESLSDSWTRLK
QRDWLFTSSYSFEYDFDLTKTLGVHTLIENVVSFVSGDVGNAPGFKEPEESMSTSPQASI
IAMEQQQLRAELRLEALHQILVLLSGMEEKGSVPLTGSRQGSGFQSSLLLTSVRLQFLAG
CFGLGTVGLAGAKGESVRLHHYQDGIRAAKRNIQIEIQVAVHKIYQQLSATLERALQANK
HHIEAQQRLLLVTVFALSVHYQPVDVSLAISTGLLNVLSQLCGTDTMLGQPLQLLPKTGI
SQLSIALKVASTRLLQILAITTGTYADKLSPKVVQSLLDLLCSQLKNLLLQAGVLLMKGK
GTEPQAKFQSNIVLNFFSGFSFKSSAVLRKQHAAELHLGDFLVFLRRVVSSKAIQSKMAS
PKWTEVLLNIASQKCSSGIPLVGNLRTRLLALHVLEAVLPACESGVEDDQMAQVVERLFS
LLSDCMWETPIAQAKHAIQIKEKEQEMKLQKQGELEEEDENLPIQEVSFDPEKAQCCLVE
NGQILTHGSGGKGYGLASTGVTSGCYQWKFYIVKENRGNEGTCVGVSRWPVHDFNHRTTS
DMWLYRAYSGNLYHNGEQTLTLSSFTQGDFITCVLDMEARTISFGKNGEEPKLAFEDVDA
AELYPCVMFYSSNPGEKVKICDMQMRGTPRDLLPGDPICSPVAAVLAEATIQLIRILHRT
DRWTHCINKKMMERLHKIKMCIKEIGQKLKKSRSVQSREENEMREEKENKEEEKGKHSRH
GLADLSELQLKTLCIEVWPVLAVIGGVDAGLRVGGRCVHKQTGRHATLLGVVKEGSTSAK
VQWDEAEITVSFPTFWSPSDTPLYNLEPCEPLPFDVARFRGLTASVLLDLTYLTGIHEDM
GKQSTKRHEKKHRHESEEKGDIEQKTEADPTSDVRTSLSSDDARSHGATNSKSENEIPSF
SLDSAPQTVESQHQIVEGKRKNHEHTSKNHDIAQSEIRAVQLSYLYLGAMKSLSALLSCS
KYAELLLIPKVLAENGHNSDCASSPVVHEDVEMRAALQFLMRHMVKRAVMRSPIKRALGL
ADLERAQAMIYKLVVHGLLEDQFGGKIKQEVDQQTEETDQTQQAQTPVTTSPSASSTTSF
MSSSLEDTTTATTPVTDTETVPASESPGVMPLSLLRQMFSSYPTTTVLPTRRAQTPPISS
LPTSPSDEVGRRQSLTSPDSQSTRPTNRTALSDPSSRLSTSPPPPAIAVPLLEMGFSLRQ
IAKAMEATGARGEADAQNITVLAMWMIEHPGNEEDEEPQSVSASDSCHVGTVSTNSCGKS
NDPCYLQSPGDIPSADGTEMEDAFNESSDNLDHSENTASGSVPPSRSRSAVTRRHKFDLA
ARTLLARAAGLYRSVQAHRNQSRREGISLQQDPGALYDFNLDEELEIDLDDEAMEAMFGQ
DLTSDNDILGMWIPEVLDWPTWHVCESEDREEVVVCELCESSVVSFNQHMKRNHPGCGRS
ANRQGYRSNGSYVDGWFGGECGSGNPYYLLCGSCREKYLTLKTKSKTSISERYKGQAPDL
IGKQDSVYEEDWDMLDVDEDDKLTGEEEFELLAGPLGLNDRRIVPEPVQFPDSDPLGASV
AMVTATNSMEETLMQIGCHGSVEKSSSGRITLGEQAAALANPHDRVMALRRVTAAAQVLL
ARTMVMRALSLLSVSGSSCSLAAGLESLGLTDIRTLVRLMCLAAAGRAGLSTSPSSVASS
SERSRGVHSKTNKPISCLAYLSTAVGCLASNTPSAAKLLVQLCTQNLISAATGVNLTTVD
DPIQLKFLPSFLRGIAEENKLVTSPNFVVTQALVALLADKGAKLRPNYDKAEIEKKGPLE
LANALAACCLSSRLSSQHRQWAAQQLVRTLAAHDRDNQTSPQTLADIGGDLRKCFFIKLE
AHQNRVMTCVWCNKKGLLATSGNDGTIRVWNVTKKQYSLQQTCVFNRLECESDESLGSPS
DPSFSPVSWSISGKYLAGALEKMVNIWQVNGGKALVDTQPHWVSALAWPEEGPATTWSSD
SPESLLVGRMDGSLGLIEVVDVSTMHRKELEHCYRKDVSVTCLAWFSEDRPFAVGYFDGK
LLLGMKEPLEKGGIILVDAHKDTLVGIKWDPTGHILMTCAKEENVKLWGPMAGCWRCLYS
LSHSSIVNGIAWCNLPGKGPKLQLLIATGCQNGLVCVWRVSQDALNILQSSVTSSEEWWE
QESNDKDNYRKSPGATCVYQLKGHITPVRTVAFSSDGLALVSGGLGGLMNIWSLRDGSIL
QTVVIGSGAIQTTVWIPDVGVAACSNRSKDVLVVSCTSEWVAANHVLATCRTALKQQGVL
GLNMAPCMRAFLERLPIMLQEQYAYEKPHVVCGDQLVHSPYMQCLASLAVGLHLDQLLCN
PPVPPHHQNCLPDPSSWNPTEWAWLECFSTTIKAAEALAKGAQFPESFTVPDLEPVPEDE
LTFLMDNSKWINGMDEQIMSWATSRPEDWHLGGKCDVYLWGAGRHGQLAEAGRNVMIPAA
APSFSQAQQVICGQNCTFVIQANGTVLACGEGSYGRLGQGNSDDLHVLTVISALQGFVVT
QLVTSCGSDGHSMALTESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEVIQMSCG
FKHSAVVTSDGKLFTFGNGDYGRLGLGNTSNKKLPERVTALEGYQIGQVACGLNHTLAVS
ADGSMVWAFGDGDYGKLGLGNSTAKSSPQKVDVLCGIGIKKVACGTQFSVALTKDGHVYT
FGQDRLIGLPEGRARNHNRPQQIPVLAGVVIEDIAVGAEHTLALASTGDVYAWGSNSEGQ
LGLGHTNHVREPTLITILQGKNIRQISAGRCHSAAWTASPVPPRAPGVSVPLQLGLPDTV
PPQYGALKEVSIHTVRARLRLLYHFSDLMYSSWRLLNLSPNNQNSTSHYNAGTWGIVQGQ
LRPLLAPRVYTLPMVRSIGKTMVQGKNYGPQITVKRISTRGRKCKPIFVQIARQVVKLNA
SDLRLPSRAWKVKLVGEGADDAGGVFDDTITEMCQELETGVVDLLIPSPNATAEVGYNRD
RFLFNPSAFLDEHLMQFKFLGILMGVAIRTKKPLDLHLAPMVWKQLCCIPLTLEDLEEVD
LLYVQTLNSILHIEDSGITEENFHEMIPLDSFVGQSADGKMVPIIPGGNSIPLTFSNRKE
YVERAIEYRLHEMDRQVAAVREGMSWIIPVPLLSLLTAKQLEQMVCGMPEISVEVLKKVV
RYREVDEQHQLVQWFWHTLEEFSNEERVLFMRFVSGRSRLPANTADISQRFQIMKVDRPY
DSLPTSQTCFFQLRLPPYSSQLIMAERLRYAINNCRSIDMDNYMLSRNVDNAEGSDTDY
Download sequence
Identical sequences F7AQD7
ENSMODP00000013730 13616.ENSMODP00000013730 ENSMODP00000013730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]