SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013743 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013743
Domain Number 1 Region: 829-907
Classification Level Classification E-value
Superfamily DEATH domain 5.72e-19
Family DEATH domain, DD 0.0000687
Further Details:      
 
Domain Number 2 Region: 286-333
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000196
Family TSP-1 type 1 repeat 0.00088
Further Details:      
 
Domain Number 3 Region: 40-142
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000511
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013743   Gene: ENSMODG00000010980   Transcript: ENSMODT00000013993
Sequence length 932
Comment pep:novel chromosome:BROADO5:1:569120016:569524548:1 gene:ENSMODG00000010980 transcript:ENSMODT00000013993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKRLFNSLGLCWTNGTYARGGNDNGDTLPESIPSAPGTLPHFMQEPDDAYIIKSNPIALR
CKAMPAMQIFFKCNGEWVHQNEHVSEESLDESTGLKVREVFINVTRQQVEDFHGPEDYWC
QCVAWSHLGTSKSRKASVRIAYLRKNFEQDPQGREVPIEGMIVLHCRPPEGVPAAEVRCI
LDLTQIYSEGDYTVLQGEISDDFRKRWKDLYGLMQSEISRTRRSLYTVTTILCNEIFSYS
QKYNDANFVCGRGYLILDSRLRGHSLCIFIYGVMSVQKDTCASLLVDGSWEVWSEWSVCS
PECEHLRIRECTAPPPRNGGKFCEGVSQESENCTDGLCIQDKKPLHEIKPQSIENASDIA
LYSGLGAAVIAVAVLVVGVTLYRRSQSDYGVDVIDSSALTGGFQTFNFKTVRQGNSLLLN
SSMQPDLTVSRTYSGPICLQDPLDKELMTESSLFNPLSDIKVKVQSSFMVSLGVSERAEY
HGKTHSGTFPHGNTRGFNTIHPRNKPPYMQNLSSLPTRTELRTTGVFGHLGGRLVMPNTG
VSLLIPHGAIPEDNSWEIYMSINQGEASLQPDGSEVLLSPEVTCGPSDMVVTTPFALTIP
HCADVSSEHWNIHLKKRTQQGKWEEVMSVEDESTSCYCLLDPFACHVLLDSFGTYALAGE
PITDCAVKQLKVAVFGCMSCNSLDYNLRVYCVDNTPCAFQEVVSDERHQGGQLLEEPKLL
HFKGNTFSLQISVLDIPPFLWRIKPFTACQEVPFSRVWCSNRQPLHCAFSLERYTPTTTQ
LSCKICIRQLKGHEQILQVQTSILESERETITFFAQEDNTFPAQTGPKAFKIPYSIRQRI
CATFDTPSAKGKDWQMLAQKNSINRNLSYFATQSSPSAVILNLWEARHQHDGDLDSLACA
LEEIGRTHTKLSNIPETQLEEPDFSYSRQNGL
Download sequence
Identical sequences F7APX6
13616.ENSMODP00000013743 ENSMODP00000013743 ENSMODP00000013743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]