SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013748 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013748
Domain Number 1 Region: 216-340
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-27
Family Cadherin 0.0014
Further Details:      
 
Domain Number 2 Region: 117-219
Classification Level Classification E-value
Superfamily Cadherin-like 7.57e-21
Family Cadherin 0.0019
Further Details:      
 
Domain Number 3 Region: 331-441
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-17
Family Cadherin 0.0013
Further Details:      
 
Domain Number 4 Region: 22-116
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000671
Family Cadherin 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013748   Gene: ENSMODG00000010970   Transcript: ENSMODT00000013998
Sequence length 564
Comment pep:novel chromosome:BROADO5:1:333167038:333174164:1 gene:ENSMODG00000010970 transcript:ENSMODT00000013998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WAQRPQVLLPFLASLFNLALSEQIRYSIPEEMEKGSVVGNLAKDLGLDIRDLSTRKLRIS
TENEYFAVSSESGELLVRGRIDREEICGSKSKCALEFETVAENPMNIFFIIVTIQDINDN
PPQFLTNYISLEISELTLPGAKFALSSARDADENGQVSCHIQENIPFKLESSSRNYHKLL
TDGPLDREQTPKYNITVIAVDKGNPPLFTSKIFILHIADINDNPPVFLQPSYVAYFSENN
PSGSSIAKVLAEDPDLEQNGRVSYSILSSDLAPLPLSSYVSVNGHSGDIFAQRSFDYEQF
RELKLGVTARDSGDSPLSSNVSLTLFILDQNDNVPEILYPAFPTDGSSGVELAPRSAEPG
YLVTKVVAVDADSGQNAWLSYHLIKATEPGLFSIGLHSGEIRTVRPFLDKDTLKQNLIVA
VTDNGELPLSATVTITIAVADSIPEILSELSNLEATDDLKDSSLTLYLVISVAAISCLFF
TFIVILLALKLHQWRTSKLLEESSGHFGNMQSSQFVGIDGVRAFLQTHTQEVSLTTDSRK
SQLIFLGPDYTDTLPKNSDKKEPP
Download sequence
Identical sequences F7APU9
ENSMODP00000013748 13616.ENSMODP00000013748 ENSMODP00000013748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]