SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013753 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013753
Domain Number 1 Region: 243-428
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-51
Family SPRY domain 0.0000627
Further Details:      
 
Domain Number 2 Region: 55-114
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000748
Family B-box zinc-binding domain 0.0025
Further Details:      
 
Domain Number 3 Region: 1-44
Classification Level Classification E-value
Superfamily RING/U-box 0.000000227
Family RING finger domain, C3HC4 0.046
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000013753
Domain Number - Region: 96-198
Classification Level Classification E-value
Superfamily Cullin repeat-like 0.0201
Family Cullin repeat 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013753   Gene: ENSMODG00000010986   Transcript: ENSMODT00000014003
Sequence length 432
Comment pep:novel chromosome:BROADO5:1:568622425:568623723:-1 gene:ENSMODG00000010986 transcript:ENSMODT00000014003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVRECVFRSWQEAQVPWTCPLCRASSQPRALEPTQVLEALASSMSRQLRLPRDVGGQARC
GQHQAVQKLFCEDDFSPLCVSCLLPQEHEGHRVYPLEESAETCKAQLQEALGQAWDKARE
AHMLLEQERERRLRCRREAATLKRVILPEYIKTHLVWTEDQQQDLLDKEKRRNVKRLWTS
EARISKYVQSLRKLIEELDKTLEQPLVEMLLAGRSTLERSRELLLRCPEPAALRWTLCGT
TGMRELLLAFQSHILLDPGTAHSYLSISGDLKSVRLASHWWDLLDNQQEEVDRLVCVLGA
QSFTSGSHYWEVEVRSKTEWEVGICTGPGNNQGSIHGDVLSLSCLNMGEQFELWISHTME
DPEDTGPLHRLGIFLQYEGGHLSFYNVTQGCLIYAFPPVTFQGPLRPFFSLGLLQEENQP
IPLTICPLSPHP
Download sequence
Identical sequences F7APH1
ENSMODP00000013753 13616.ENSMODP00000013753 ENSMODP00000013753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]