SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013869 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013869
Domain Number 1 Region: 24-186
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.22e-37
Family MAM domain 0.0000047
Further Details:      
 
Domain Number 2 Region: 386-589
Classification Level Classification E-value
Superfamily Fibronectin type III 7.7e-29
Family Fibronectin type III 0.00086
Further Details:      
 
Domain Number 3 Region: 284-421
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000156
Family Fibronectin type III 0.0052
Further Details:      
 
Domain Number 4 Region: 189-282
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000416
Family I set domains 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013869   Gene: ENSMODG00000011076   Transcript: ENSMODT00000014122
Sequence length 773
Comment pep:novel chromosome:BROADO5:4:368507977:368586730:1 gene:ENSMODG00000011076 transcript:ENSMODT00000014122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGAQAFILALTFQLCALESETPTAGCSFDEDGDPVAPCEYSQAQYDDFQWERVRNDAGT
RSPPDLPHGSYLMVNSSQHAPGQRAHVVFQSLSENDTHCLQFSYFLYSRDGHSPGALGVY
VRVNGGPLGSAVWNMSGSHGRQWHQAELAVSTFWPNEYQVLFEAVISTDRRGYMGLDDIL
LFSYPCAKAPHFSRLGDVEVNAGQNATFQCMAAGRASEAEQFLLQRQGGLMVPAASVKHI
SHRRFLATFQLPEVGRGEQDLYRCVSQAPRGAGVSNFAELIVKEPPTPIAPPQLLRAGST
YLIIQLNTNSIIGDGPIVRKEIEYRMSRGPWAEVHAVSMQTYKLWHLDPDTEYEISVLLT
RPGEGGTGKPGPALVSRTKCAEPMKAPKGLAFSEIQSRQLTLQWEPLGYNVTRCHTYTVS
LCYRYTVGSSHNQTFRECVKMERGTNRYTIKNLLPYRNIHVRLILANPEGRKEGKEVIFQ
TDEDVPGGISAESLTFTPLEDMIFLKWEEPLEPNGLITQYEISYQSIESSDPAVNVPGPR
RTVSKLRNETYHVFSNLHPGTTYLFSVRARTGKGFGQTALTEITTNISAPSFDYGDMPSP
LGESESTITVLLRPAQGRGAPISVYQVIVEEDRARRMKREPGGQDCFPVPLTFDAALARG
AVHYFGAELPASSLLEATPFTVGDNQTYRGYWNPPLEPKKAYLIYFQATSHLKGETRLNC
IRIARKAACKESKRPLEVSQHSEEMGLILGVCAGGLVVLIILLGAIIIIIRKG
Download sequence
Identical sequences F7E681
ENSMODP00000013869 XP_007491570.1.35504 ENSMODP00000013869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]