SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013873 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013873
Domain Number 1 Region: 952-1057
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.7e-31
Family Calponin-homology domain, CH-domain 0.00015
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000013873
Domain Number - Region: 687-780
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0034
Family Myosin rod fragments 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013873   Gene: ENSMODG00000011081   Transcript: ENSMODT00000014126
Sequence length 1059
Comment pep:novel chromosome:BROADO5:2:519325169:519672577:1 gene:ENSMODG00000011081 transcript:ENSMODT00000014126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSVAKPWNASIKQGTHGVERGRPLPSTTSGMKTSKSSTSLSFESRLSKLKRASSDDMLS
KPGNTTSSGVARLKKTVTAGAISELSENRLKSCVGTISSTKRTGIPAPRELSAPTSRERI
ALRGPSSAKKPIPSPISSSTPTPTKHLRGNNKSKLENDAGDKAMLESQVRELLAEAKTKD
FEISKLRSELKKFKEKGSPNATEGTDALGQNGDELQSSPADLDPLIRTLQEKNRNFEKEL
VDLGEENRVLKEKLAYMEHSPSSEAAMSNDGGSSLPTPTTQESSFGSPTRNQLSGEAEEY
KQSMTGNTLRTSGSSSSDVTKASLSPDASDFEHIVEAPSRPLSSGSITFKSPRCSTGGSS
PNNISELSVASLTEKIQKMEENHHSTTEELQATLQELSDQQQMVQELTAENEKLADEKTL
LETSFHQHRERAEQLSQENEKLMNLLQEREQEEEASAQDSSKVKELEQRCSEILENAQFE
REKLLNIQQQLTCSLRKIEGENQGAAEMIKCLKEENQQLNGLLDRERHNNSLATQALEDC
RVSLEGLKIENASLKAQLESEKQKVAEMSAQGHMRDSSEVQDKLKVARAEKDQLELSCIE
LKQELLKANSEIQHIQNMLSKVEKECGYLKEICDQQAEQLNQTSLQFQEKTSESDAEIKD
MKETIFELEDQVEQHRAVKLHNNQLISELESNVMKLEEQKLDLERQLKTLTKQIKEETEE
WRRFQADLQTAVVVANDIKCEAQQELRTVKRKLLEEEEKNAKLQKELGAVQGNSRSVNEE
PDSSEMDGPSRWQGICVSRTSPTPSESAATVKSLIKSFDLGCSGGPGQSVSVHKTPRSPL
SGIPVRTAPAAAVSPIQRHSTYSSLRPAGKGMTKLSDLPDLPLTDILKGRNEDLKPDHYL
RKSPSLESLSRPPSLGFSHARLLTPTPGGLKPQSKLSVERKDPLAALAREYGGSKRNALL
KWCQKKTEGYPNIDITNFSSSWSDGLAFCALLHTYLPAHIPYQELNSQEKKRNLLLAFQA
AESVGITPSLELSEMLYTDRPDWQSVMQYVAQIYKYFET
Download sequence
Identical sequences F7E5V1
XP_007485860.1.35504 XP_007485861.1.35504 XP_007485862.1.35504 XP_007485863.1.35504 XP_016284797.1.35504 XP_016284798.1.35504 ENSMODP00000013873 ENSMODP00000013873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]