SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013924 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013924
Domain Number 1 Region: 364-442
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 6.1e-25
Family Intermediate filament protein, coiled coil region 0.0000422
Further Details:      
 
Domain Number 2 Region: 132-168
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000148
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 
Domain Number 3 Region: 139-246
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000011
Family Myosin rod fragments 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000013924
Domain Number - Region: 254-362
Classification Level Classification E-value
Superfamily Prefoldin 0.00915
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013924   Gene: ENSMODG00000011125   Transcript: ENSMODT00000014178
Sequence length 538
Comment pep:novel chromosome:BROADO5:1:108729142:108747035:-1 gene:ENSMODG00000011125 transcript:ENSMODT00000014178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLGERPASYAPLPTPPPAPYNLGAQSRAQPSLLLGSLAVTCMMSFSSDHYLCSSSYRKV
FGDGSRLSSRFGGSGSGGFRSQSLSRCNVTSSGACSASSSLGLGLSYRRTGPENLDLSQA
AARNNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRALEAELAALRQRHAEPSRVG
ELFQRELRELRAQLEEASSARTQALLERDGLAEEVQRLRARCEEESRGREGAERALKAQQ
RDVDGATLARLDLEKKVEALLDELAFLRQVHEEEVSELLATLQASSQASAEVDMTVAKPD
LTSALREIRAQYESLAAKNLQSAEEWYKSKFANLNEQAARSTEAIRASREEIHEYRRQLQ
ARTIEIEGLRGANESLERQILEMEERHSAEVAGFQDSIGQLENDLRNTKSEMARHLREYQ
DLLNVKMALDIEIAAYRKLLEGEETRFSTSGMTISGLNPPPNPGYVVPSRMFSSTASKAS
PPVLSFKKEEKEEASKVASKKASQIGESFAEIMEETIISTKKTEKSNLEEVTISSQKI
Download sequence
Identical sequences F7BB74
ENSMODP00000013924 ENSMODP00000013924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]