SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014021 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014021
Domain Number 1 Region: 30-220,248-336,378-496
Classification Level Classification E-value
Superfamily Cytochrome P450 9.52e-79
Family Cytochrome P450 0.00000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014021   Gene: ENSMODG00000011205   Transcript: ENSMODT00000014279
Sequence length 509
Comment pep:novel chromosome:BROADO5:1:109199272:109208337:1 gene:ENSMODG00000011205 transcript:ENSMODT00000014279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWWFLTISLLTLLYYIWQKQGSMGKKYLICMPHLPILGSLPYMNFHDPAHVYFTKLKEKY
GNTFAFWMGPQYSVVVNHFSAAKEVLLKKGKDFASRPRMVTTDILSGSGKGIAFSEYGPQ
WRMYRKLVQSSFSLLKDGSQKLEKLICQEANTLCKSLAAAQGKIQDPATDIFLASSNVIC
QFCFSSSWNKDDEDFEIMMDYSNNILKTLKDSLVDIFPWIQARAIGPCPALFPNKDLALL
KDSVTLRNELLKKKLEIQKEKFNIDSVNNLLDALLKAKLDSDNPLVQEPEITDEHILMTV
GDIFGAGVETTSTVVRWCIAFLLHHPQVGLPNCSNMHLSLSPNPYPPNTGEDNSKCLKAH
GSAVCSSPISTYLIVPIPPISQGIGEYTIPKGTRIYINLWSIHHDPTQWNEPERFMPERF
LDKNKDQLIIPNASYFPFGSGPRVCVGEFLARSELFLFLAWILQRFDLEVPDDGELPSLD
GLSGVVFQIIPFKLKVKLRKGWREAELSA
Download sequence
Identical sequences F6SQD6
ENSMODP00000014021 13616.ENSMODP00000014021 ENSMODP00000014021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]